• Gene id: 29985

Gene Summary

• Gene Symbol: SLC39A3   Gene   UCSC   Ensembl
• Aliases: ZIP-3, ZIP3
• Gene name: solute carrier family 39 member 3
• Alternate names: zinc transporter ZIP3, solute carrier family 39 (zinc transporter), member 3, zrt- and Irt-like protein 3,
• Gene location: 19p13.3 (2740075: 2732523)     Exons: 3     NC_000019.10
• OMIM: 614777

Protein Summary

• Protein general information: Q9BRY0  
  • Name: Zinc transporter ZIP3 (Solute carrier family 39 member 3) (Zrt and Irt like protein 3) (ZIP 3)
  • Length: 314  
  • Mass: 33601
• Sequence:

  MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCFNALLPAVREKLQKVL
  SLGHISTDYPLAETILLLGFFMTVFLEQLILTFRKEKPSFIDLETFNAGSDVGSDSEYESPFMGGARGHALYVEP
  HGHGPSLSVQGLSRASPVRLLSLAFALSAHSVFEGLALGLQEEGEKVVSLFVGVAVHETLVAVALGISMARSAMP
  LRDAAKLAVTVSAMIPLGIGLGLGIESAQGVPGSVASVLLQGLAGGTFLFITFLEILAKELEEKSDRLLKVLFLV
  LGYTVLAGMVFLKW

• Structural information:
  • Interpro: IPR003689  
  • STRING: ENSP00000269740
• Other Databases: GeneCards:  SLC39A3  Malacards:  SLC39A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071577	zinc ion transmembrane transport	IBA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IBA	molecular function
GO:0016020	membrane	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0030001	metal ion transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0046873	metal ion transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0006829	zinc ion transport	IEA	biological process
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0000902	cell morphogenesis	IEA	biological process
GO:0005385	zinc ion transmembrane transporter activity	IEA	molecular function
GO:0043029	T cell homeostasis	IEA	biological process
GO:0048701	embryonic cranial skeleton morphogenesis	IEA	biological process
GO:0001701	in utero embryonic development	IEA	biological process
GO:0006829	zinc ion transport	IEA	biological process
GO:0060173	limb development	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R