• Gene id: 29982

Gene Summary

• Gene Symbol: NRBF2   Gene   UCSC   Ensembl
• Aliases: COPR, COPR1, COPR2, NRBF-2
• Gene name: nuclear receptor binding factor 2
• Alternate names: nuclear receptor-binding factor 2, comodulator of PPAR and RXR 1, comodulator of PPAR and RXR 2,
• Gene location: 10q21.3 (63133246: 63155030)     Exons: 5     NC_000010.11
• OMIM: 603123

Protein Summary

• Protein general information: Q96F24  
  • Name: Nuclear receptor binding factor 2 (NRBF 2) (Comodulator of PPAR and RXR)
  • Length: 287  
  • Mass: 32378
  • Tissue specificity: Detected in keratinocytes, liver and placenta (PubMed
• Sequence:

  MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERW
  KRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSE
  PAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETS
  ELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

• Structural information:
  • Interpro: IPR039679  IPR015056  IPR033393  
  • PDB: 4ZEY
  • PDBsum: 4ZEY
  • STRING: ENSP00000277746
• Other Databases: GeneCards:  NRBF2  Malacards:  NRBF2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006914	autophagy	IBA	biological process
GO:0035032	phosphatidylinositol 3-kinase complex, class III	IBA	colocalizes with
GO:0035032	phosphatidylinositol 3-kinase complex, class III	IDA	colocalizes with
GO:0006914	autophagy	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043550	regulation of lipid kinase activity	IEA	biological process
GO:0035032	phosphatidylinositol 3-kinase complex, class III	IEA	cellular component
GO:0034976	response to endoplasmic reticulum stress	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005776	autophagosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006914	autophagy	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05017	Spinocerebellar ataxia
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881