• Gene id: 29974

Gene Summary

• Gene Symbol: A1CF   Gene   UCSC   Ensembl
• Aliases: ACF, ACF64, ACF65, APOBEC1CF, ASP
• Gene name: APOBEC1 complementation factor
• Alternate names: APOBEC1 complementation factor, APOBEC-1 stimulating protein, apo-B RNA editing protein, apobec-1 complementation factor (ACF) (ASP),
• Gene location: 10q11.23 (50885674: 50799408)     Exons: 15     NC_000010.11
• Gene summary(Entrez): Mammalian apolipoprotein B mRNA undergoes site-specific C to U deamination, which is mediated by a multi-component enzyme complex containing a minimal core composed of APOBEC-1 and a complementation factor encoded by this gene. The gene product has three
• OMIM: 618199

Protein Summary

• Protein general information: Q9NQ94  
  • Name: APOBEC1 complementation factor (APOBEC1 stimulating protein)
  • Length: 594  
  • Mass: 65202
  • Tissue specificity: Widely expressed with highest levels in brain, liver, pancreas, colon and spleen. {ECO
• Sequence:

  MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFIGKLPRDLFEDELIPL
  CEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYEIRNGRLLGVCASVDNCRLFVGGIPKTKKRE
  EILSEMKKVTEGVVDVIVYPSAADKTKNRGFAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDED
  TMSSVKILYVRNLMLSTSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
  AKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQTYAAIPSLHFPATKGHLSNRAIIR
  APSVREIYMNVPVGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPGMELTPMNPVTLKPQGIKLAPQI
  LEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPALASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIP
  TDGGDGTMATAAAAATAFPGYAVPNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF

• Structural information:
  • Protein Domains: (56..13-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (136..21-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (231..30-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR033111  IPR034538  IPR034539  IPR006535  IPR012677   IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12486 cd12498
  • PDB: 2CPD
  • PDBsum: 2CPD
  • STRING: ENSP00000378868
• Other Databases: GeneCards:  A1CF  Malacards:  A1CF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003729	mRNA binding	IBA	molecular function
GO:0016556	mRNA modification	IEA	biological process
GO:0030895	apolipoprotein B mRNA editing enzyme complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003727	single-stranded RNA binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	TAS	molecular function
GO:0016554	cytidine to uridine editing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003725	double-stranded RNA binding	IDA	NOT|molecular function
GO:0050821	protein stabilization	IDA	biological process
GO:0030895	apolipoprotein B mRNA editing enzyme complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0003727	single-stranded RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Gout	PMID:28252667
Gout	PMID:28679452
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)