• Gene id: 29969

Gene Summary

• Gene Symbol: MDFIC   Gene   UCSC   Ensembl
• Aliases: HIC, MDFIC1
• Gene name: MyoD family inhibitor domain containing
• Alternate names: myoD family inhibitor domain-containing protein, I-mfa domain-containing protein,
• Gene location: 7q31.1-q31.2 (114922153: 115019915)     Exons: 6     NC_000007.14
• Gene summary(Entrez): This gene product is a member of a family of proteins characterized by a specific cysteine-rich C-terminal domain, which is involved in transcriptional regulation of viral genome expression. Alternative translation initiation from an upstream non-AUG (GUG
• OMIM: 0

Protein Summary

• Protein general information: Q9P1T7  
  • Name: MyoD family inhibitor domain containing protein (I mfa domain containing protein) (hIC)
  • Length: 246  
  • Mass: 25788
  • Tissue specificity: Expressed in lymphoid organs (spleen, thymus, peripheral blood leukocytes) as well as prostate, uterus and small intestine. {ECO
• Sequence:

  MSGAGEALAPGPVGPQRVAEAGGGQLGSTAQGKCDKDNTEKDITQATNSHFTHGEMQDQSIWGNPSDGELIRTQP
  QRLPQLQTSAQVPSGEEIGKIKNGHTGLSNGNGIHHGAKHGSADNRKLSAPVSQKMHRKIQSSLSVNSDISKKSK
  VNAVFSQKTGSSPEDCCVHCILACLFCEFLTLCNIVLGQASCGICTSEACCCCCGDEMGDDCNCPCDMDCGIMDA
  CCESSDCLEICMECCGICFPS

• Structural information:
  • Protein Domains: (74..24-)
    (/note="MDFI"-)
  • Interpro: IPR026134  
  • STRING: ENSP00000484656
• Other Databases: GeneCards:  MDFIC  Malacards:  MDFIC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0007257	activation of JUN kinase activity	IDA	biological process
GO:0050434	positive regulation of viral transcription	IDA	biological process
GO:0030957	Tat protein binding	IDA	molecular function
GO:0030957	Tat protein binding	IDA	molecular function
GO:0030111	regulation of Wnt signaling pathway	IDA	biological process
GO:0030332	cyclin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0050434	positive regulation of viral transcription	IBA	biological process
GO:0008134	transcription factor binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	ISS	biological process
GO:0042308	negative regulation of protein import into nucleus	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)