• Gene id: 29967

Gene Summary

• Gene Symbol: LRP12   Gene   UCSC   Ensembl
• Aliases: MIG13A, ST7
• Gene name: LDL receptor related protein 12
• Alternate names: low-density lipoprotein receptor-related protein 12, LDLR-related protein 12, suppressor of tumorigenicity 7 protein,
• Gene location: 8q22.3 (104589023: 104489230)     Exons: 7     NC_000008.11
• Gene summary(Entrez): This gene encodes a member of the low-density lipoprotein receptor related protein family. The product of this gene is a transmembrane protein that is differentially expressed in many cancer cells. Alternate splicing results in multiple transcript variant
• OMIM: 618299

Protein Summary

• Protein general information: Q9Y561  
  • Name: Low density lipoprotein receptor related protein 12 (LDLR related protein 12) (LRP 12) (Suppressor of tumorigenicity 7 protein)
  • Length: 859  
  • Mass: 94984
  • Tissue specificity: Widely expressed in heart, skeletal muscle, brain, lung, placenta and pancreas, but not in tissues consisting of a large number of epithelial cells, such as liver and kidney. Expressed at very low levels in a number of tumor-derived ce
• Sequence:

  MACRWSTKESPRWRSALLLLFLAGVYGNGALAEHSENVHISGVSTACGETPEQIRAPSGIITSPGWPSEYPAKIN
  CSWFIRANPGEIITISFQDFDIQGSRRCNLDWLTIETYKNIESYRACGSTIPPPYISSQDHIWIRFHSDDNISRK
  GFRLAYFSGKSEEPNCACDQFRCGNGKCIPEAWKCNNMDECGDSSDEEICAKEANPPTAAAFQPCAYNQFQCLSR
  FTKVYTCLPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPPGSNCTWLIDTGDHRKVILR
  FTDFKLDGTGYGDYVKIYDGLEENPHKLLRVLTAFDSHAPLTVVSSSGQIRVHFCADKVNAARGFNATYQVDGFC
  LPWEIPCGGNWGCYTEQQRCDGYWHCPNGRDETNCTMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCFF
  CQPGNFHCKNNRCVFESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVIGSLICGLLLVIALGCTCKLYSLRMFE
  RRSFETQLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLAVRSQLGFTSVRLPMAGRSS
  NIWNRIFNFARSRHSGSLALVSADGDEVVPSQSTSREPERNHTHRSLFSVESDDTDTENERRDMAGASGGVAAPL
  PQKVPPTTAVEATVGACASSSTQSTRGGHADNGRDVTSVEPPSVSPARHQLTSALSRMTQGLRWVRFTLGRSSSL
  SQNQSPLRQLDNGVSGREDDDDVEMLIPISDGSSDFDVNDCSRPLLDLASDQGQGLRQPYNATNPGVRPSNRDGP
  CERCGIVHTAQIPDTCLEVTLKNETSDDEALLLC

• Structural information:
  • Protein Domains: (47..15-)
    (/note="CUB-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00059-)
    (165..20-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00124-)
    (214..25-)
    A (/note="LDL-receptor-class)
    (/evidence="ECO:00002-)
  • Interpro: IPR000859  IPR036055  IPR023415  IPR002172  IPR035914  
  • Prosite: PS01180 PS01209 PS50068
  • CDD: cd00041 cd00112
  • STRING: ENSP00000276654
• Other Databases: GeneCards:  LRP12  Malacards:  LRP12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0031175	neuron projection development	IDA	biological process
GO:0001764	neuron migration	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031175	neuron projection development	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0005905	clathrin-coated pit	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0040008	regulation of growth	NAS	biological process
GO:0006897	endocytosis	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005041	low-density lipoprotein particle receptor activity	NAS	molecular function
GO:0007165	signal transduction	NAS	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray