• Gene id: 29966

Gene Summary

• Gene Symbol: STRN3   Gene   UCSC   Ensembl
• Aliases: PPP2R6B, S/G2NA, SG2NA
• Gene name: striatin 3
• Alternate names: striatin-3, cell cycle S/G2 nuclear autoantigen, cell cycle autoantigen SG2NA, nuclear autoantigen, protein phosphatase 2 regulatory subunit B'''beta, s/G2 antigen, striatin, calmodulin binding protein 3,
• Gene location: 14q12 (31026400: 30893803)     Exons: 18     NC_000014.9
• OMIM: 614766

Protein Summary

• Protein general information: Q13033  
  • Name: Striatin 3 (Cell cycle autoantigen SG2NA) (S/G2 antigen)
  • Length: 797  
  • Mass: 87209
• Sequence:

  MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRPQQYTIPGILHYIQHE
  WARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTELNQGDLKMPT
  FESEETKDTEAPTAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQRVRSLLGLSNSEPNGSVETKNLEQILN
  GGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNKHKIGNEGLAADLTDDPDTEE
  ALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISKLKEQYKKERKGKKGVKRANRTKLYD
  MIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFPSGGGKSFIMGSDDVLLSVLGLGDLADLTVT
  NDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHPVEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEP
  IYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWWNMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQ
  LLSCSADGTVRLWNPQEKLPCICTYNGDKKHGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVD
  SGLQSNNHINRVVSHPTLPVTITAHEDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLW
  NLDSKTCVQEITAHRKKLDESIYDVAFHSSKAYIASAGADALAKVFV

• Structural information:
  • Interpro: IPR020472  IPR013258  IPR015943  IPR001680  IPR019775   IPR017986  IPR036322  
  • Prosite: PS00678 PS50082 PS50294
  • PDB: 4N6J 6AKL 6IUR
  • PDBsum: 4N6J 6AKL 6IUR
  • STRING: ENSP00000350071
• Other Databases: GeneCards:  STRN3  Malacards:  STRN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070016	armadillo repeat domain binding	IBA	molecular function
GO:0030425	dendrite	IBA	cellular component
GO:0005516	calmodulin binding	IBA	molecular function
GO:0051721	protein phosphatase 2A binding	IBA	molecular function
GO:0044877	protein-containing complex binding	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030425	dendrite	IEA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0043025	neuronal cell body	IEA	cellular component
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0051721	protein phosphatase 2A binding	IDA	molecular function
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0090443	FAR/SIN/STRIPAK complex	IDA	cellular component
GO:0070016	armadillo repeat domain binding	IPI	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0005516	calmodulin binding	NAS	molecular function
GO:0043025	neuronal cell body	ISS	cellular component
GO:0032991	protein-containing complex	ISS	cellular component
GO:0033147	negative regulation of intracellular estrogen receptor signaling pathway	ISS	biological process
GO:0032355	response to estradiol	ISS	biological process
GO:0017048	Rho GTPase binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq