• Gene id: 2996

Gene Summary

• Gene Symbol: GYPE   Gene   UCSC   Ensembl
• Aliases: GPE, GYPA, MNS, MiIX
• Gene name: glycophorin E (MNS blood group)
• Alternate names: glycophorin-E, glycophorin A,
• Gene location: 4q31.21 (143912130: 143870863)     Exons: 6     NC_000004.12
• Gene summary(Entrez): The protein encoded by this gene is a sialoglycoprotein and a type I membrane protein. It is a member of a gene family with GPA and GPB genes. This encoded protein might carry the M blood group antigen. GYPA, GYPB, and GYPE are organized in tandem on chro
• OMIM: 609018

Protein Summary

• Protein general information: P15421  
  • Name: Glycophorin E
  • Length: 78  
  • Mass: 8463
  • Tissue specificity: Erythrocytes.
• Sequence:

  MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIFEVMLVVVGMIILISY
  CIR

• Structural information:
  • Interpro: IPR001195  
  • STRING: ENSP00000351430
• Other Databases: GeneCards:  GYPE  Malacards:  GYPE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881