• Gene id: 29959

Gene Summary

• Gene Symbol: NRBP1   Gene   UCSC   Ensembl
• Aliases: BCON3, MADM, MUDPNP, NRBP
• Gene name: nuclear receptor binding protein 1
• Alternate names: nuclear receptor-binding protein, multiple domain putative nuclear protein, myeloid leukemia factor 1 adaptor molecule,
• Gene location: 2p23.3 (27427789: 27442258)     Exons: 20     NC_000002.12
• OMIM: 606010

Protein Summary

• Protein general information: Q9UHY1  
  • Name: Nuclear receptor binding protein
  • Length: 535  
  • Mass: 59845
  • Tissue specificity: Ubiquitously expressed in all tissues examined with high levels in the testis. {ECO
• Sequence:

  MSEGESQTVLSSGSDPKVESSSSAPGLTSVSPPVTSTTSAASPEEEEESEDESEILEESPCGRWQKRREEVNQRN
  VPGIDSAYLAMDTEEGVEVVWNEVQFSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIKENKARVIFIT
  EYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIHGNLTCDTIFIQHNGLIKIGSVAPDT
  INNHVKTCREEQKNLHFFAPEYGEVTNVTTAVDIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDPLQ
  REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPENALEEITKNMDTSAVLAEIPAGPGR
  EPVQTLYSQSPALELDKFLEDVRNGIYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCN
  IESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNST
  LNSAAVTVSS

• Structural information:
  • Protein Domains: (68..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR001245  
  • Prosite: PS50011
  • STRING: ENSP00000233557
• Other Databases: GeneCards:  NRBP1  Malacards:  NRBP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	NOT|molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0006468	protein phosphorylation	IBA	NOT|biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005938	cell cortex	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0006468	protein phosphorylation	IEA	biological process
GO:0012505	endomembrane system	IDA	cellular component
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IDA	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R