• Gene id: 29957

Gene Summary

• Gene Symbol: SLC25A24   Gene   UCSC   Ensembl
• Aliases: APC1, SCAMC-1, SCAMC1
• Gene name: solute carrier family 25 member 24
• Alternate names: calcium-binding mitochondrial carrier protein SCaMC-1, calcium-binding transporter, mitochondrial ATP-Mg/Pi carrier protein 1, mitochondrial Ca(2+)-dependent solute carrier protein 1, short calcium-binding mitochondrial carrier 1, small calcium-binding mitocho,
• Gene location: 1p13.3 (108200342: 108134042)     Exons: 11     NC_000001.11
• Gene summary(Entrez): This gene encodes a carrier protein that transports ATP-Mg exchanging it for phosphate. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]
• OMIM: 608744

Protein Summary

• Protein general information: Q6NUK1  
  • Name: Calcium binding mitochondrial carrier protein SCaMC 1 (Mitochondrial ATP Mg/Pi carrier protein 1) (Mitochondrial Ca(2+) dependent solute carrier protein 1) (Small calcium binding mitochondrial carrier protein 1) (Solute carrier family 25 member 24)
  • Length: 477  
  • Mass: 53354
  • Tissue specificity: Present in various cell lines (at protein level). Expressed in all tissues tested. Highly expressed in testis, expressed at intermediate level in small intestine and pancreas, and weakly expressed in kidney, spleen, liver, skeletal mus
• Sequence:

  MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKL
  DFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGLTISEQQAELILQSIDVDGTMTVDWNEWRDY
  FLFNPVTDIEEIIRFWKHSTGIDIGDSLTIPDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVH
  GSKSDKMNIFGGFRQMVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
  TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGIDLAVYELLKSYWLDN
  FAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLEGSPQLNMVGLFRRIISKEGIPGLYRGITPN
  FMKVLPAVGISYVVYENMKQTLGVTQK

• Structural information:
  • Protein Domains: (19..5-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (55..8-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (86..12-)
    (/note="EF-hand-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU0044-)
  • Interpro: IPR011992  IPR018247  IPR002048  IPR002167  IPR002067   IPR018108  IPR023395  
  • Prosite: PS00018 PS50222 PS50920
  • PDB: 4N5X 4ZCU 4ZCV
  • PDBsum: 4N5X 4ZCU 4ZCV
  • STRING: ENSP00000457733
• Other Databases: GeneCards:  SLC25A24  Malacards:  SLC25A24

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005347	ATP transmembrane transporter activity	IBA	molecular function
GO:0005509	calcium ion binding	IDA	molecular function
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0071277	cellular response to calcium ion	IMP	biological process
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0015867	ATP transport	IMP	biological process
GO:0010941	regulation of cell death	IMP	biological process
GO:0005347	ATP transmembrane transporter activity	IMP	molecular function
GO:0034599	cellular response to oxidative stress	IMP	biological process
GO:0006839	mitochondrial transport	IMP	biological process
GO:0006839	mitochondrial transport	IMP	biological process
GO:0005347	ATP transmembrane transporter activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881