• Gene id: 2995

Gene Summary

• Gene Symbol: GYPC   Gene   UCSC   Ensembl
• Aliases: CD236, CD236R, GE, GPC, GPD, GYPD, PAS-2, PAS-2'
• Gene name: glycophorin C (Gerbich blood group)
• Alternate names: glycophorin-C, glycoconnectin, glycophorin-D, glycoprotein beta, sialoglycoprotein D,
• Gene location: 2q14.3 (126655934: 126696674)     Exons: 6     NC_000002.12
• Gene summary(Entrez): Glycophorin C (GYPC) is an integral membrane glycoprotein. It is a minor species carried by human erythrocytes, but plays an important role in regulating the mechanical stability of red cells. A number of glycophorin C mutations have been described. The G

Protein Summary

• Protein general information: P04921  
  • Name: Glycophorin C (Glycoconnectin) (Glycophorin D) (GPD) (Glycoprotein beta) (PAS 2') (Sialoglycoprotein D) (CD antigen CD236)
  • Length: 128  
  • Mass: 13811
  • Tissue specificity: Glycophorin-C is expressed in erythrocytes. Glycophorin-D and IsoGPC are ubiquitously expressed. {ECO
• Sequence:

  MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVS
  LLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

• Structural information:
  • Interpro: IPR001195  IPR042192  IPR003585  
  • PDB: 2EJY
  • PDBsum: 2EJY
  • STRING: ENSP00000259254
• Other Databases: GeneCards:  GYPC  Malacards:  GYPC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030863	cortical cytoskeleton	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	NAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0030863	cortical cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030863	cortical cytoskeleton	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05144	Malaria

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R