• Gene id: 29949

Gene Summary

• Gene Symbol: IL19   Gene   UCSC   Ensembl
• Aliases: IL-10C, MDA1, NG.1, ZMDA1
• Gene name: interleukin 19
• Alternate names: interleukin-19, melanoma differentiation associated protein-like protein,
• Gene location: 1q32.1 (206770772: 206842980)     Exons: 9     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a cytokine that belongs to the IL10 cytokine subfamily. This cytokine is found to be preferentially expressed in monocytes. It can bind the IL20 receptor complex and lead to the activation of the signal transducer and a
• OMIM: 612765

Protein Summary

• Protein general information: Q9UHD0  
  • Name: Interleukin 19 (IL 19) (Melanoma differentiation associated protein like protein) (NG.1)
  • Length: 177  
  • Mass: 20452
• Sequence:

  MKLQCVSLWLLGTILILCSVDNHGLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVC
  CVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVH
  AAAIKSLGELDVFLAWINKNHEVMFSA

• Structural information:
  • Interpro: IPR009079  IPR020443  IPR020423  IPR020421  
  • Prosite: PS00520
  • PDB: 1N1F
  • PDBsum: 1N1F
  • STRING: ENSP00000343000
• Other Databases: GeneCards:  IL19  Malacards:  IL19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0005615	extracellular space	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0005125	cytokine activity	TAS	molecular function
GO:0006955	immune response	NAS	biological process
GO:0005576	extracellular region	NAS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04060	Cytokine-cytokine receptor interaction
hsa04630	JAK-STAT signaling pathway
hsa04061	Viral protein interaction with cytokine and cytokine receptor

Diseases

Associated diseases	References
Asthma	PMID:15557163
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881