• Gene id: 29948

Gene Summary

• Gene Symbol: OSGIN1   Gene   UCSC   Ensembl
• Aliases: BDGI, OKL38
• Gene name: oxidative stress induced growth inhibitor 1
• Alternate names: oxidative stress-induced growth inhibitor 1, BMSC-derived growth inhibitor, bone marrow stromal cell-derived growth inhibitor, ovary, kidney and liver protein 38, pregnancy-induced growth inhibitor OKL38,
• Gene location: 16q23.3 (83953239: 83966331)     Exons: 6     NC_000016.10
• Gene summary(Entrez): This gene encodes an oxidative stress response protein that regulates cell death. Expression of the gene is regulated by p53 and is induced by DNA damage. The protein regulates apoptosis by inducing cytochrome c release from mitochondria. It also appears
• OMIM: 607975

Protein Summary

• Protein general information: Q9UJX0  
  • Name: Oxidative stress induced growth inhibitor 1 (Bone marrow stromal cell derived growth inhibitor) (BMSC derived growth inhibitor) (Ovary, kidney and liver protein 38) (huOKL38) (Pregnancy induced growth inhibitor OKL38)
  • Length: 477  
  • Mass: 51992
  • Tissue specificity: Ubiquitous. Highest expression in the ovary, testis, kidney, skeletal muscle and liver (PubMed
• Sequence:

  MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEAPGVSILDQDLDYLSE
  GLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHVVLGRNLPGGAWHSIEGSMVILSQGQWMGLP
  DLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGF
  LTRNQAQQPFSLWARNVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
  VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRSLPRHQLLCFKEDCQA
  VFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAG
  DNFVRFVQGGALAVASSLLRKETRKPP

• Structural information:
  • Interpro: IPR036188  IPR029731  IPR029724  
  • STRING: ENSP00000355374
• Other Databases: GeneCards:  OSGIN1  Malacards:  OSGIN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008083	growth factor activity	IBA	molecular function
GO:0030308	negative regulation of cell growth	IBA	biological process
GO:0030334	regulation of cell migration	IMP	biological process
GO:0042127	regulation of cell population proliferation	IMP	biological process
GO:0042981	regulation of apoptotic process	IMP	biological process
GO:0030308	negative regulation of cell growth	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0008083	growth factor activity	IDA	molecular function
GO:0005575	cellular_component	ND	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq