• Gene id: 29944

Gene Summary

• Gene Symbol: PNMA3   Gene   UCSC   Ensembl
• Aliases: MA3, MA5
• Gene name: PNMA family member 3
• Alternate names: paraneoplastic antigen Ma3, paraneoplastic Ma antigen 3, paraneoplastic cancer-testis-brain antigen,
• Gene location: Xq28 (153056469: 153060461)     Exons: 28     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene belongs to the paraneoplastic antigen MA (PNMA) family, which shares homology with retroviral Gag proteins. The PNMA antigens are highly expressed in the brain and also in a range of tumors associated with serious neurolog
• OMIM: 300675

Protein Summary

• Protein general information: Q9UL41  
  • Name: Paraneoplastic antigen Ma3
  • Length: 463  
  • Mass: 52376
  • Tissue specificity: Expressed at high levels in the brain and testis. Expressed at lower levels in the heart, trachea and kidney. {ECO
• Sequence:

  MPLTLLQDWCRGEHLNTRRCMLILGIPEDCGEDEFEETLQEACRHLGRYRVIGRMFRREENAQAILLELAQDIDY
  ALLPREIPGKGGPWEVIVKPRNSDGEFLNRLNRFLEEERRTVSDMNRVLGSDTNCSAPRVTISPEFWTWAQTLGA
  AVQPLLEQMLYRELRVFSGNTISIPGALAFDAWLEHTTEMLQMWQVPEGEKRRRLMECLRGPALQVVSGLRASNA
  SITVEECLAALQQVFGPVESHKIAQVKLCKAYQEAGEKVSSFVLRLEPLLQRAVENNVVSRRNVNQTRLKRVLSG
  ATLPDKLRDKLKLMKQRRKPPGFLALVKLLREEEEWEATLGPDRESLEGLEVAPRPPARITGVGAVPLPASGNSF
  DARPSQGYRRRRGRGQHRRGGVARAGSRGSRKRKRHTFCYSCGEDGHIRVQCINPSNLLLVKQKKQAAVESGNGN
  WAWDKSHPKSKAK

• Structural information:
  • Interpro: IPR026523  IPR026529  IPR001878  IPR036875  
  • Prosite: PS50158
  • STRING: ENSP00000469445
• Other Databases: GeneCards:  PNMA3  Malacards:  PNMA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	ISS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881