• Gene id: 29942

Gene Summary

• Gene Symbol: PURG   Gene   UCSC   Ensembl
• Aliases: PURG-A, PURG-B, PURGA, PURGB
• Gene name: purine rich element binding protein G
• Alternate names: purine-rich element-binding protein gamma, Pur-gamma,
• Gene location: 8p12 (31033355: 30995801)     Exons: 3     NC_000008.11
• Gene summary(Entrez): The exact function of this gene is not known, however, its encoded product is highly similar to purine-rich element binding protein A. The latter is a DNA-binding protein which binds preferentially to the single strand of the purine-rich element termed PU
• OMIM: 612112

Protein Summary

• Protein general information: Q9UJV8  
  • Name: Purine rich element binding protein gamma (Purine rich element binding protein G)
  • Length: 347  
  • Mass: 39556
  • Tissue specificity: Isoform 1 is expressed in testis and glioblastoma. Isoform 2 is expressed in fetal lung. {ECO
• Sequence:

  MERARRRGGGGGRGRGGKNVGGSGLSKSRLYPQAQHSHYPHYAASATPNQAGGAAEIQELASKRVDIQKKRFYLD
  VKQSSRGRFLKIAEVWIGRGRQDNIRKSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGHSKEQGSRRRQ
  KHSAPSPPVSVGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQEQTIVLP
  AQGMIEFRDALVQLIEDYGEGDIEERRGGDDDPLELPEGTSFRVDNKRFYFDVGSNKYGIFLKVSEVRPPYRNTI
  TVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRKASGEEQECLD

• Structural information:
  • Interpro: IPR006628  IPR030501  
  • STRING: ENSP00000418721
• Other Databases: GeneCards:  PURG  Malacards:  PURG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003690	double-stranded DNA binding	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0001227	DNA-binding transcription repressor activity, RNA polymerase II-specific	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0032422	purine-rich negative regulatory element binding	IBA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0032422	purine-rich negative regulatory element binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray