• Gene id: 29937

Gene Summary

• Gene Symbol: NENF   Gene   UCSC   Ensembl
• Aliases: CIR2, SCIRP10, SPUF
• Gene name: neudesin neurotrophic factor
• Alternate names: neudesin, SCIRP10-related protein, Spinal cord injury related protein 10, cell growth-inhibiting protein 47, cell immortalization-related protein 2, neuron-derived neurotrophic factor, secreted protein of unknown function,
• Gene location: 1q32.3 (212432919: 212446378)     Exons: 1     NC_000001.11
• Gene summary(Entrez): This gene encodes a neurotrophic factor that may play a role in neuron differentiation and development. A pseudogene of this gene is found on chromosome 12. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan
• OMIM: 611874

Protein Summary

• Protein general information: Q9UMX5  
  • Name: Neudesin (Cell immortalization related protein 2) (Neuron derived neurotrophic factor) (Protein GIG47) (Secreted protein of unknown function) (SPUF protein)
  • Length: 172  
  • Mass: 18856
  • Tissue specificity: Ubiquitously expressed with high expression in heart. Over-expressed in various tumors including carcinomas of the uterine cervix, lymphoma, colon, lung, skin and leukemia, as well as carcinoma of the breast. {ECO
• Sequence:

  MVGPAPRRRLRPLAALALVLALAPGLPTARAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDV
  TSGKEFYGRGAPYNALTGKDSTRGVAKMSLDPADLTHDTTGLTAKELEALDEVFTKVYKAKYPIVGYTARRILNE
  DGSPNLDFKPEDQPHFDIKDEF

• Structural information:
  • Protein Domains: (44..12-)
    heme-binding" (/note="Cytochrome-b5)
  • Interpro: IPR001199  IPR036400  
  • STRING: ENSP00000355955
• Other Databases: GeneCards:  NENF  Malacards:  NENF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0012505	endomembrane system	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0032099	negative regulation of appetite	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0032099	negative regulation of appetite	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0008083	growth factor activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005615	extracellular space	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:1901215	negative regulation of neuron death	IMP	biological process
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray