• Gene id: 29919

Gene Summary

• Gene Symbol: RMC1   Gene   UCSC   Ensembl
• Aliases: C18orf8, HsT2591, MIC1, Mic-1, WDR98
• Gene name: regulator of MON1-CCZ1
• Alternate names: regulator of MON1-CCZ1 complex, WD repeat domain 98, WD repeat-containing protein 98, colon cancer-associated protein Mic1, macrophage inhibitory cytokine 1, uncharacterized protein C18orf8,
• Gene location: 18q11.2 (23503469: 23531821)     Exons: 20     NC_000018.10
• Gene summary(Entrez): This gene encodes a colon cancer associated protein. [provided by RefSeq, Jan 2013]

Protein Summary

• Protein general information: Q96DM3  
  • Name: Regulator of MON1 CCZ1 complex (Colon cancer associated protein Mic1) (Mic 1) (WD repeat containing protein 98)
  • Length: 657  
  • Mass: 74975
• Sequence:

  MGEEDYYLELCERPVQFEKANPVNCVFFDEANKQVFAVRSGGATGVVVKGPDDRNPISFRMDDKGEVKCIKFSLE
  NKILAVQRTSKTVDFCNFIPDNSQLEYTQECKTKNANILGFCWTSSTEIVFITDQGIEFYQVLPEKRSLKLLKSH
  NLNVNWYMYCPESAVILLSTTVLENVLQPFHFRAGTMSKLPKFEIELPAAPKSTKPSLSERDIAMATIYGQLYVL
  FLRHHSRTSNSTGAEVVLYHLPREGACKKMHILKLNRTGKFALNVVDNLVVVHHQDTETSVIFDIKLRGEFDGSV
  TFHHPVLPARSIQPYQIPITGPAAVTSQSPVPCKLYSSSWIVFQPDIIISASQGYLWNLQVKLEPIVNLLPDKGR
  LMDFLLQRKECKMVILSVCSQMLSESDRASLPVIATVFDKLNHEYKKYLDAEQSYAMAVEAGQSRSSPLLKRPVR
  TQAVLDQSDVYTHVLSAFVEKKEMPHKFVIAVLMEYIRSLNQFQIAVQHYLHELVIKTLVQHNLFYMLHQFLQYH
  VLSDSKPLACLLLSLESFYPPAHQLSLDMLKRLSTANDEIVEVLLSKHQVLAALRFIRGIGGHDNISARKFLDAA
  KQTEDNMLFYTIFRFFEQRNQRLRGSPNFTPGEHCEEHVAFFKQIFGDQALMRPTTF

• Structural information:
  • Protein Domains: (471..63-)
    (/note="Mic1"-)
  • Interpro: IPR040371  IPR009755  IPR015943  IPR036322  
  • STRING: ENSP00000269221
• Other Databases: GeneCards:  RMC1  Malacards:  RMC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035658	Mon1-Ccz1 complex	IBA	cellular component
GO:0031902	late endosome membrane	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0035658	Mon1-Ccz1 complex	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0010506	regulation of autophagy	IMP	biological process
GO:0010506	regulation of autophagy	IEA	biological process
GO:0035658	Mon1-Ccz1 complex	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component
GO:0035658	Mon1-Ccz1 complex	IBA	cellular component
GO:0031902	late endosome membrane	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0035658	Mon1-Ccz1 complex	IDA	cellular component
GO:0031902	late endosome membrane	IDA	cellular component
GO:0010506	regulation of autophagy	IMP	biological process
GO:0010506	regulation of autophagy	IEA	biological process
GO:0035658	Mon1-Ccz1 complex	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005764	lysosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006914	autophagy	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0031902	late endosome membrane	IEA	cellular component
GO:0005765	lysosomal membrane	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881