• Gene id: 29909

Gene Summary

• Gene Symbol: GPR171   Gene   UCSC   Ensembl
• Aliases: H963
• Gene name: G protein-coupled receptor 171
• Alternate names: probable G-protein coupled receptor 171, F730001G15Rik, G-protein coupled receptor H963, platelet activating receptor homolog,
• Gene location: 3q25.1 (151203673: 151197753)     Exons: 4     NC_000003.12

Protein Summary

• Protein general information: O14626  
  • Name: Probable G protein coupled receptor 171 (G protein coupled receptor H963)
  • Length: 319  
  • Mass: 36754
• Sequence:

  MTNSSFFCPVYKDLEPFTYFFYLVFLVGIIGSCFATWAFIQKNTNHRCVSIYLINLLTADFLLTLALPVKIVVDL
  GVAPWKLKIFHCQVTACLIYINMYLSIIFLAFVSIDRCLQLTHSCKIYRIQEPGFAKMISTVVWLMVLLIMVPNM
  MIPIKDIKEKSNVGCMEFKKEFGRNWHLLTNFICVAIFLNFSAIILISNCLVIRQLYRNKDNENYPNVKKALINI
  LLVTTGYIICFVPYHIVRIPYTLSQTEVITDCSTRISLFKAKEATLLLAVSNLCFDPILYYHLSKAFRSKVTETF
  ASPKETKAQKEKLRCENNA

• Structural information:
  • Interpro: IPR000276  IPR017452  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000308479
• Other Databases: GeneCards:  GPR171  Malacards:  GPR171

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045028	G protein-coupled purinergic nucleotide receptor activity	IBA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0045638	negative regulation of myeloid cell differentiation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0035589	G protein-coupled purinergic nucleotide receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	NAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	NAS	biological process
GO:0004930	G protein-coupled receptor activity	NAS	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R