• Gene id: 29906

Gene Summary

• Gene Symbol: ST8SIA5   Gene   UCSC   Ensembl
• Aliases: SIAT8-E, SIAT8E, ST8SiaV
• Gene name: ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5
• Alternate names: alpha-2,8-sialyltransferase 8E, ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 5, sialyltransferase 8E (alpha-2, 8-polysialytransferase), sialyltransferase St8Sia V,
• Gene location: 18q21.1 (46757052: 46667820)     Exons: 9     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene is a type II membrane protein that may be present in the Golgi apparatus. The encoded protein, which is a member of glycosyltransferase family 29, may be involved in the synthesis of gangliosides GD1c, GT1a, GQ1b, and GT3
• OMIM: 606947

Protein Summary

• Protein general information: O15466  
  • Name: Alpha 2,8 sialyltransferase 8E (EC 2.4.99. ) (Sialyltransferase 8E) (SIAT8 E) (Sialyltransferase St8Sia V) (ST8SiaV)
  • Length: 376  
  • Mass: 43895
  • Tissue specificity: [Isoform 1]
• Sequence:

  MRYADPSANRDLLGSRTLLFIFICAFALVTLLQQILYGRNYIKRYFEFYEGPFEYNSTRCLELRHEILEVKVLSM
  VKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTTQKNTPLGTKLKYEVDTSGIYHINQEIFRMF
  PKDMPYYRSQFKKCAVVGNGGILKNSRCGREINSADFVFRCNLPPISEKYTMDVGVKTDVVTVNPSIITERFHKL
  EKWRRPFYRVLQVYENASVLLPAFYNTRNTDVSIRVKYVLDDFESPQAVYYFHPQYLVNVSRYWLSLGVRAKRIS
  TGLILVTAALELCEEVHLFGFWAFPMNPSGLYITHHYYDNVKPRPGFHAMPSEIFNFLHLHSRGILRVHTGTCSC
  C

• Structural information:
  • Interpro: IPR001675  IPR038578  IPR012163  
  • STRING: ENSP00000321343
• Other Databases: GeneCards:  ST8SIA5  Malacards:  ST8SIA5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006486	protein glycosylation	IBA	biological process
GO:0006491	N-glycan processing	IBA	biological process
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	molecular function
GO:0009311	oligosaccharide metabolic process	IBA	biological process
GO:0000139	Golgi membrane	ISS	cellular component
GO:0006688	glycosphingolipid biosynthetic process	ISS	biological process
GO:0008373	sialyltransferase activity	ISS	molecular function
GO:0006486	protein glycosylation	IEA	biological process
GO:0008373	sialyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008373	sialyltransferase activity	TAS	molecular function
GO:0005975	carbohydrate metabolic process	TAS	biological process
GO:0006688	glycosphingolipid biosynthetic process	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003828	alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0097503	sialylation	IEA	biological process
GO:0006486	protein glycosylation	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00604	Glycosphingolipid biosynthesis - ganglio series

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq