• Gene id: 29904

Gene Summary

• Gene Symbol: EEF2K   Gene   UCSC   Ensembl
• Aliases: CaMKIII, HSU93850, eEF-2K
• Gene name: eukaryotic elongation factor 2 kinase
• Alternate names: eukaryotic elongation factor 2 kinase, alternative protein EEF2K, calcium/calmodulin-dependent eukaryotic elongation factor-2 kinase, calmodulin-dependent protein kinase III, eEF-2 kinase, elongation factor-2 kinase, eukaroytic elongation factor 2 kinase,
• Gene location: 16p12.2 (22206277: 22288737)     Exons: 20     NC_000016.10
• Gene summary(Entrez): This gene encodes a highly conserved protein kinase in the calmodulin-mediated signaling pathway that links activation of cell surface receptors to cell division. This kinase is involved in the regulation of protein synthesis. It phosphorylates eukaryotic
• OMIM: 606968

Protein Summary

• Protein general information: O00418  
  • Name: Eukaryotic elongation factor 2 kinase (eEF 2 kinase) (eEF 2K) (EC 2.7.11.20) (Calcium/calmodulin dependent eukaryotic elongation factor 2 kinase)
  • Length: 725  
  • Mass: 82144
• Sequence:

  MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYYSNLTKSERYSSSGSP
  ANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAVTGEWLDDEVLIKMASQPFGRGAMRECFRTK
  KLSNFLHAQQWKGASNYVAKRYIEPVDRDVYFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPL
  FHLEHYIEGKYIKYNSNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
  GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSPQVRTLSGSRPPLLRP
  LSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDNMASRDHDHLDNHRESENSGDSGYPSEKRGE
  LDDPEPREHGHSYSNRKYESDEDSLGSSGRVCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGK
  VHLAMVRYHEGGRFCEKGEEWDQESAVFHLEHAANLGELEAIVGLGLMYSQLPHHILADVSLKETEENKTKGFDY
  LLKAAEAGDRQSMILVARAFDSGQNLSPDRCQDWLEALHWYNTALEMTDCDEGGEYDGMQDEPRYMMLAREAEML
  FTGGYGLEKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAWAQMEE

• Structural information:
  • Protein Domains: (116..32-)
    kinase (/note="Alpha-type-protein)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00501"-)
  • Interpro: IPR017400  IPR011009  IPR004166  IPR006597  IPR011990  
  • Prosite: PS51158
  • PDB: 5J8H 5KS5 6NX4
  • PDBsum: 5J8H 5KS5 6NX4
  • STRING: ENSP00000263026
• Other Databases: GeneCards:  EEF2K  Malacards:  EEF2K

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0005516	calmodulin binding	IDA	molecular function
GO:0004686	elongation factor-2 kinase activity	IDA	molecular function
GO:0004686	elongation factor-2 kinase activity	IEA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0008135	translation factor activity, RNA binding	TAS	molecular function
GO:0006414	translational elongation	TAS	biological process
GO:0004672	protein kinase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0004686	elongation factor-2 kinase activity	IEA	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0002931	response to ischemia	IEA	biological process
GO:0004686	elongation factor-2 kinase activity	IEA	molecular function
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0045807	positive regulation of endocytosis	IEA	biological process
GO:0061003	positive regulation of dendritic spine morphogenesis	IEA	biological process
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:1990416	cellular response to brain-derived neurotrophic factor stimulus	IEA	biological process
GO:0004686	elongation factor-2 kinase activity	IEA	molecular function
GO:0005516	calmodulin binding	IEA	molecular function
GO:0031952	regulation of protein autophosphorylation	IEA	biological process
GO:0014069	postsynaptic density	IEA	cellular component
GO:0043197	dendritic spine	IEA	cellular component
GO:0051965	positive regulation of synapse assembly	IEA	biological process
GO:0071454	cellular response to anoxia	IEA	biological process
GO:1990637	response to prolactin	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04921	Oxytocin signaling pathway
hsa04152	AMPK signaling pathway

Diseases

Associated diseases	References
Alzheimer's disease	PMID:16098202
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq