• Gene id: 29899

Gene Summary

• Gene Symbol: GPSM2   Gene   UCSC   Ensembl
• Aliases: CMCS, DFNB82, LGN, PINS
• Gene name: G protein signaling modulator 2
• Alternate names: G-protein-signaling modulator 2, G-protein signalling modulator 2 (AGS3-like, C. elegans), mosaic protein LGN,
• Gene location: 1p13.3 (108875349: 108934544)     Exons: 19     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene belongs to a family of proteins that modulate activation of G proteins, which transduce extracellular signals received by cell surface receptors into integrated cellular responses. The N-terminal half of this protein conta
• OMIM: 609245

Protein Summary

• Protein general information: P81274  
  • Name: G protein signaling modulator 2 (Mosaic protein LGN)
  • Length: 684  
  • Mass: 76662
  • Tissue specificity: Ubiquitously expressed.
• Sequence:

  MEENLISMREDHSFHVRYRMEASCLELALEGERLCKSGDCRAGVSFFEAAVQVGTEDLKTLSAIYSQLGNAYFYL
  HDYAKALEYHHHDLTLARTIGDQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGN
  VYHAKGKSFGCPGPQDVGEFPEEVRDALQAAVDFYEENLSLVTALGDRAAQGRAFGNLGNTHYLLGNFRDAVIAH
  EQRLLIAKEFGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQLKDRAVEAQSCYSLGNTYTLLQDYEK
  AIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREVGDKSGELTARLNLSDLQMVL
  GLSYSTNNSIMSENTEIDSSLNGVRPKLGRRHSMENMELMKLTPEKVQNWNSEILAKQKPLIAKPSAKLLFVNRL
  KGKKYKTNSSTKVLQDASNSIDHRIPNSQRKISADTIGDEGFFDLLSRFQSNRMDDQRCCLQEKNCHTASTTTSS
  TPPKMMLKTSSVPVVSPNTDEFLDLLASSQSRRLDDQRASFSNLPGLRLTQNSQSVLSHLMTNDNKEADEDFFDI
  LVKCQGSRLDDQRCAPPPATTKGPTVPDEDFFSLILRSQGKRMDEQRVLLQRDQNRDTDFGLKDFLQNNALLEFK
  NSGKKSADH

• Structural information:
  • Protein Domains: (489..51-)
    (/note="GoLoco-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00097-)
    (544..56-)
    (/note="GoLoco-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00097-)
    (594..61-)
    (/note="GoLoco-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00-)
  • Interpro: IPR003109  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50877 PS50005 PS50293
  • PDB: 3SF4 4WND 4WNE 4WNF 4WNG 5A6C 6HC2
  • PDBsum: 3SF4 4WND 4WNE 4WNF 4WNG 5A6C 6HC2
  • DIP: 399
  • STRING: ENSP00000385510
• Other Databases: GeneCards:  GPSM2  Malacards:  GPSM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0099738	cell cortex region	IDA	cellular component
GO:0099738	cell cortex region	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	cellular component
GO:0005938	cell cortex	IDA	cellular component
GO:0097431	mitotic spindle pole	IDA	colocalizes with
GO:0070840	dynein complex binding	IDA	molecular function
GO:0097575	lateral cell cortex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0000132	establishment of mitotic spindle orientation	IMP	biological process
GO:0000132	establishment of mitotic spindle orientation	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0031291	Ran protein signal transduction	IMP	biological process
GO:1904778	positive regulation of protein localization to cell cortex	IMP	biological process
GO:0007052	mitotic spindle organization	IMP	biological process
GO:0051661	maintenance of centrosome location	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005092	GDP-dissociation inhibitor activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:1905832	positive regulation of spindle assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030695	GTPase regulator activity	IEA	molecular function
GO:0051301	cell division	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0097575	lateral cell cortex	IEA	cellular component
GO:0005092	GDP-dissociation inhibitor activity	IEA	molecular function
GO:0001965	G-protein alpha-subunit binding	IEA	molecular function
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0005938	cell cortex	IDA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0043621	protein self-association	IMP	molecular function
GO:0005938	cell cortex	IMP	colocalizes with
GO:0008022	protein C-terminus binding	IPI	molecular function
GO:0032991	protein-containing complex	IMP	cellular component

Diseases

Associated diseases	References
Deafness, autosomal recessive	KEGG:H00605
Deafness, autosomal recessive	KEGG:H00605
Sensorineural hearing loss	PMID:20602914
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R