• Gene id: 29890

Gene Summary

• Gene Symbol: RBM15B   Gene   UCSC   Ensembl
• Aliases: HUMAGCGB, HsOTT3, OTT3
• Gene name: RNA binding motif protein 15B
• Alternate names: putative RNA-binding protein 15B, chromosome 3p21.1 gene sequence, huOTT3, one twenty two protein 3,
• Gene location: 3p21.2 (51391284: 51397907)     Exons: 1     NC_000003.12
• Gene summary(Entrez): Members of the SPEN (Split-end) family of proteins, including RBM15B, have repressor function in several signaling pathways and may bind to RNA through interaction with spliceosome components (Hiriart et al., 2005 [PubMed 16129689]).[supplied by OMIM, Feb
• OMIM: 130660

Protein Summary

• Protein general information: Q8NDT2  
  • Name: Putative RNA binding protein 15B (One twenty two protein 3) (HsOTT3) (HuOTT3) (RNA binding motif protein 15B)
  • Length: 890  
  • Mass: 97205
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MKRQSERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPARARDKPRGSGSGGGGHRDGRGTGD
  ANHRASSGRSSGSGAGGGGRGGKASGDPGASGMSPRASPLPPPPPPPGAEPACPGSSAAAPEYKTLLISSLSPAL
  PAEHLEDRLFHQFKRFGEISLRLSHTPELGRVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLRGGGGS
  SRRSSSSSAAASTPPPGPPAPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSR
  ERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKYGIIEEVVIKRPARGQ
  GGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRLWVGGLGPNTSLAALAREFDRFGSIRTIDHV
  KGDSFAYIQYESLDAAQAACAKMRGFPLGGPDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDA
  DLVRDRTPPHLLYSDRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLS
  SDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADS
  SHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQLGWNGLLVLKNSCFPTSMHILEGDQGVISSL
  LKDHTSGSKLTQLKIAQRLRLDQPKLDEVTRRIKQGSPNGYAVLLATQATPSGLGTEGMPTVEPGLQRRLLRNLV
  SYLKQKQAAGVISLPVGGSKGRDGTGMLYAFPPCDFSQQYLQSALRTLGKLEEEHMVIVIVRDTA

• Structural information:
  • Protein Domains: (139..21-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (337..41-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (418..49-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (-)
  • Interpro: IPR012677  IPR035979  IPR034475  IPR034535  IPR034536   IPR000504  IPR016194  IPR012921  IPR010912  
  • Prosite: PS50102 PS50917
  • CDD: cd12554 cd12556 cd12558
  • STRING: ENSP00000454545
• Other Databases: GeneCards:  RBM15B  Malacards:  RBM15B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	NOT|biological process
GO:0001510	RNA methylation	IDA	biological process
GO:0009048	dosage compensation by inactivation of X chromosome	IDA	biological process
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006406	mRNA export from nucleus	ISS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006913	nucleocytoplasmic transport	IDA	NOT|biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	NAS	molecular function
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IBA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	NOT|biological process
GO:0001510	RNA methylation	IDA	biological process
GO:0009048	dosage compensation by inactivation of X chromosome	IDA	biological process
GO:0036396	RNA N6-methyladenosine methyltransferase complex	IDA	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0003723	RNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006406	mRNA export from nucleus	ISS	biological process
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0016032	viral process	IEA	biological process
GO:0008380	RNA splicing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016607	nuclear speck	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0005635	nuclear envelope	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0005654	nucleoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006913	nucleocytoplasmic transport	IDA	NOT|biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0000381	regulation of alternative mRNA splicing, via spliceosome	IDA	biological process
GO:0005654	nucleoplasm	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	NAS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq