• Gene id: 29887

Gene Summary

• Gene Symbol: SNX10   Gene   UCSC   Ensembl
• Aliases: OPTB8
• Gene name: sorting nexin 10
• Alternate names: sorting nexin-10,
• Gene location: 7p15.2 (26291861: 26374382)     Exons: 12     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like
• OMIM: 614780

Protein Summary

• Protein general information: Q9Y5X0  
  • Name: Sorting nexin 10
  • Length: 201  
  • Mass: 23598
• Sequence:

  MFPEQQKEEFVSVWVRDPRIQKEDFWHSYIDYEICIHTNSMCFTMKTSCVRRRYREFVWLRQRLQSNALLVQLPE
  LPSKNLFFNMNNRQHVDQRRQGLEDFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKFA
  LMNRRFPEEDEEGKKENDIDYDSESSSSGLGHSSDDSSSHGCKVNTAPQES

• Structural information:
  • Protein Domains: (10..12-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR001683  IPR036871  
  • Prosite: PS50195
  • PDB: 4ON3 4PZG
  • PDBsum: 4ON3 4PZG
  • STRING: ENSP00000395474
• Other Databases: GeneCards:  SNX10  Malacards:  SNX10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031313	extrinsic component of endosome membrane	IDA	cellular component
GO:0005813	centrosome	IDA	colocalizes with
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0060271	cilium assembly	IMP	biological process
GO:0007032	endosome organization	IMP	biological process
GO:0071539	protein localization to centrosome	IMP	biological process
GO:0061512	protein localization to cilium	IMP	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0030316	osteoclast differentiation	ISS	biological process
GO:0005545	1-phosphatidylinositol binding	IMP	molecular function
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0030030	cell projection organization	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0045453	bone resorption	IEA	biological process
GO:0044691	tooth eruption	IEA	biological process
GO:0030316	osteoclast differentiation	IEA	biological process
GO:0030282	bone mineralization	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0001696	gastric acid secretion	IEA	biological process
GO:0097178	ruffle assembly	IEA	biological process
GO:0090651	apical cytoplasm	IEA	cellular component
GO:0055074	calcium ion homeostasis	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component

Diseases

Associated diseases	References
Osteopetrosis	KEGG:H00436
Osteopetrosis	KEGG:H00436
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq