• Gene id: 29886

Gene Summary

• Gene Symbol: SNX8   Gene   UCSC   Ensembl
• Aliases: Mvp1
• Gene name: sorting nexin 8
• Alternate names: sorting nexin-8,
• Gene location: 7p22.3 (132878319: 132890313)     Exons: 7     NC_000009.12
• OMIM: 614905

Protein Summary

• Protein general information: Q9Y5X2  
  • Name: Sorting nexin 8
  • Length: 465  
  • Mass: 52569
• Sequence:

  MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQELLARD
  TVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGADREFIEARRR
  ALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFLPADIQAQFAISRELI
  RNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSSTWGSLKQALKGLSVEFALLAD
  KAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYSLMKRQMMSATAQNREPESVEQLESR
  IVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVNSQIQGHKEMSKVWNDLRPKLSCLFAGPHST
  LTPPCSPPEDGLCPH

• Structural information:
  • Protein Domains: (73..18-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR027267  IPR001683  IPR036871  IPR028662  IPR035704  
  • Prosite: PS50195
  • CDD: cd06866
  • STRING: ENSP00000222990
• Other Databases: GeneCards:  SNX8  Malacards:  SNX8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031901	early endosome membrane	IDA	cellular component
GO:0030904	retromer complex	IDA	colocalizes with
GO:0034498	early endosome to Golgi transport	IMP	biological process
GO:0035091	phosphatidylinositol binding	IMP	molecular function
GO:0006886	intracellular protein transport	IMP	biological process
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IEA	biological process
GO:0008289	lipid binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq