• Gene id: 29882

Gene Summary

• Gene Symbol: ANAPC2   Gene   UCSC   Ensembl
• Aliases: APC2
• Gene name: anaphase promoting complex subunit 2
• Alternate names: anaphase-promoting complex subunit 2, cyclosome subunit 2,
• Gene location: 9q34.3 (137188584: 137174783)     Exons: 14     NC_000009.12
• Gene summary(Entrez): A large protein complex, termed the anaphase-promoting complex (APC), or the cyclosome, promotes metaphase-anaphase transition by ubiquitinating its specific substrates such as mitotic cyclins and anaphase inhibitor, which are subsequently degraded by the
• OMIM: 607162

Protein Summary

• Protein general information: Q9UJX6  
  • Name: Anaphase promoting complex subunit 2 (APC2) (Cyclosome subunit 2)
  • Length: 822  
  • Mass: 93828
• Sequence:

  MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVEVLRGHGLHSVLEEWF
  VEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLESRLDPYLRSLELLEKWTRLGLLMGTGAQGLR
  EEVHTMLRGVLFFSTPRTFQEMIQRLYGCFLRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCS
  SDKQQCWCRQALEQFHQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
  GKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIEDLKYCLERTDQRQQLL
  VSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRRYLRTREDTVRQIVAGLTGDSDGTG
  DLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLAD
  RLLHQFSFSPEREIRNVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
  WPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVILLYFQDQAS
  WTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEERPQDRDNMVLIDSDDESDSGMASQADQKEEE
  LLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS

• Structural information:
  • Interpro: IPR014786  IPR016158  IPR036317  IPR001373  IPR036388   IPR036390  
  • Prosite: PS50069
  • PDB: 4UI9 4YII 5A31 5G04 5G05 5KHR 5KHU 5L9T 5L9U 5LCW 6NXK 6OB1 6Q6G 6Q6H
  • PDBsum: 4UI9 4YII 5A31 5G04 5G05 5KHR 5KHU 5L9T 5L9U 5LCW 6NXK 6OB1 6Q6G 6Q6H
  • DIP: 32957
  • STRING: ENSP00000314004
• Other Databases: GeneCards:  ANAPC2  Malacards:  ANAPC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005680	anaphase-promoting complex	IBA	cellular component
GO:0070979	protein K11-linked ubiquitination	IDA	biological process
GO:0005680	anaphase-promoting complex	IDA	cellular component
GO:0031915	positive regulation of synaptic plasticity	ISS	biological process
GO:0090129	positive regulation of synapse maturation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006511	ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0031145	anaphase-promoting complex-dependent catabolic process	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0006511	ubiquitin-dependent protein catabolic process	TAS	biological process
GO:1901990	regulation of mitotic cell cycle phase transition	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0090129	positive regulation of synapse maturation	IEA	biological process
GO:0050775	positive regulation of dendrite morphogenesis	IEA	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0031915	positive regulation of synaptic plasticity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05166	Human T-cell leukemia virus 1 infection
hsa04120	Ubiquitin mediated proteolysis
hsa04110	Cell cycle
hsa04114	Oocyte meiosis
hsa04914	Progesterone-mediated oocyte maturation

Diseases

Associated diseases	References
aplastic anemia	PMID:28968996
primary angle-closure glaucoma	PMID:29332228
lung adenocarcinoma	PMID:12036940
Lung adenoma	PMID:14647414
acute myeloid leukemia	PMID:26046517
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq