• Gene id: 29880

Gene Summary

• Gene Symbol: ALG5   Gene   UCSC   Ensembl
• Aliases: bA421P11.2
• Gene name: ALG5 dolichyl-phosphate beta-glucosyltransferase
• Alternate names: dolichyl-phosphate beta-glucosyltransferase, Alg5, S. cerevisiae, homolog of, asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphate beta-glucosyltransferase), asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-gl,
• Gene location: 13q13.3 (36999366: 36949737)     Exons: 11     NC_000013.11
• Gene summary(Entrez): This gene encodes a member of the glycosyltransferase 2 family. The encoded protein participates in glucosylation of the oligomannose core in N-linked glycosylation of proteins. The addition of glucose residues to the oligomannose core is necessary to ens
• OMIM: 604565

Protein Summary

• Protein general information: Q9Y673  
  • Name: Dolichyl phosphate beta glucosyltransferase (DolP glucosyltransferase) (EC 2.4.1.117) (Asparagine linked glycosylation protein 5 homolog)
  • Length: 324  
  • Mass: 36946
  • Tissue specificity: Expressed in pancreas, placenta, liver, heart, brain, kidney, skeletal muscle, and lung.
• Sequence:

  MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYN
  EEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMG
  IFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWF
  LCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMG
  KDLLFIRLRYLTGAWRLEQTRKMN

• Structural information:
  • Interpro: IPR035518  IPR001173  IPR029044  
  • CDD: cd04188
  • STRING: ENSP00000239891
• Other Databases: GeneCards:  ALG5  Malacards:  ALG5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006487	protein N-linked glycosylation	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016757	transferase activity, transferring glycosyl groups	IEA	molecular function
GO:0004576	oligosaccharyl transferase activity	TAS	molecular function
GO:0006486	protein glycosylation	TAS	biological process
GO:0004581	dolichyl-phosphate beta-glucosyltransferase activity	IEA	molecular function
GO:0018279	protein N-linked glycosylation via asparagine	TAS	biological process
GO:0004581	dolichyl-phosphate beta-glucosyltransferase activity	TAS	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0007368	determination of left/right symmetry	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00510	N-Glycan biosynthesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881