• Gene id: 29844

Gene Summary

• Gene Symbol: TFPT   Gene   UCSC   Ensembl
• Aliases: FB1, INO80F, amida
• Gene name: TCF3 fusion partner
• Alternate names: TCF3 fusion partner, INO80 complex subunit F, TCF3 (E2A) fusion partner (in childhood Leukemia), amida, partner of the E2A,
• Gene location: 19q13.42 (54115674: 54107012)     Exons: 7     NC_000019.10

Protein Summary

• Protein general information: P0C1Z6  
  • Name: TCF3 fusion partner (INO80 complex subunit F) (Protein FB1)
  • Length: 253  
  • Mass: 28278
• Sequence:

  MELEQREGTMAAVGFEEFSAPPGSELALPPLFGGHILESELETEVEFVSGGLGGSGLRERDEEEEAARGRRRRQR
  ELNRRKYQALGRRCREIEQVNERVLNRLHQVQRITRRLQQERRFLMRVLDSYGDDYRASQFTIVLEDEGSQGTDA
  PTPGNAENEPPEKETLSPPRRTPAPPEPGSPAPGEGPSGRKRRRVPRDGRRAGNALTPELAPVQIKVEEDFGFEA
  DEALDSSWVSRGPDKLLPYPTLASPASD

• Structural information:
  • Interpro: IPR033555  
  • STRING: ENSP00000375639
• Other Databases: GeneCards:  TFPT  Malacards:  TFPT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003677	DNA binding	IBA	molecular function
GO:0031011	Ino80 complex	IBA	cellular component
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0097190	apoptotic signaling pathway	IBA	biological process
GO:0031011	Ino80 complex	IDA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005634	nucleus	ISS	cellular component
GO:0003677	DNA binding	ISS	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq