• Gene id: 29843

Gene Summary

• Gene Symbol: SENP1   Gene   UCSC   Ensembl
• Aliases: SuPr-2
• Gene name: SUMO specific peptidase 1
• Alternate names: sentrin-specific protease 1, SUMO1/sentrin specific peptidase 1, SUMO1/sentrin specific protease 1, sentrin/SUMO-specific protease SENP1,
• Gene location: 12q13.11 (48106307: 48042892)     Exons: 21     NC_000012.12
• Gene summary(Entrez): This gene encodes a cysteine protease that specifically targets members of the small ubiquitin-like modifier (SUMO) protein family. This protease regulates SUMO pathways by deconjugating sumoylated proteins. This protease also functions to process the pre
• OMIM: 612157

Protein Summary

• Protein general information: Q9P0U3  
  • Name: Sentrin specific protease 1 (EC 3.4.22. ) (Sentrin/SUMO specific protease SENP1)
  • Length: 644  
  • Mass: 73481
  • Tissue specificity: Highly expressed in testis. Expressed at lower levels in thymus, pancreas, spleen, liver, ovary and small intestine. {ECO
• Sequence:

  MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTCSTRSAAYNPSYYSDN
  PSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSF
  PIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSS
  SKNTLKDSLFKNGNSCASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPH
  QPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQIEEQKALALQLQNQRL
  QEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEFPEITEEMEKEIKNVFRNGNQDEVLSEAFRL
  TITRKDIQTLNHLNWLNDEIINFYMNMLMERSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILL
  VPIHLGVHWCLAVVDFRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNG
  SDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL

• Structural information:
  • Interpro: IPR038765  IPR003653  
  • Prosite: PS50600
  • PDB: 2CKG 2CKH 2G4D 2IY0 2IY1 2IYC 2IYD 2XPH 2XRE 6NNQ
  • PDBsum: 2CKG 2CKH 2G4D 2IY0 2IY1 2IYC 2IYD 2XPH 2XRE 6NNQ
  • DIP: 29252
  • STRING: ENSP00000394791
• Other Databases: GeneCards:  SENP1  Malacards:  SENP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016926	protein desumoylation	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0016926	protein desumoylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070140	SUMO-specific isopeptidase activity	ISS	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004175	endopeptidase activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0006508	proteolysis	TAS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0016925	protein sumoylation	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032435	negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0016926	protein desumoylation	IEA	biological process
GO:0010724	regulation of definitive erythrocyte differentiation	IEA	biological process
GO:0070140	SUMO-specific isopeptidase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)