• Gene id: 29842

Gene Summary

• Gene Symbol: TFCP2L1   Gene   UCSC   Ensembl
• Aliases: CRTR1, LBP-9, LBP9
• Gene name: transcription factor CP2 like 1
• Alternate names: transcription factor CP2-like protein 1, CP2-related transcriptional repressor 1, CRTR-1, transcription factor LBP-9,
• Gene location: 2q14.2 (36187496: 36272156)     Exons: 15     NC_000018.10
• OMIM: 609785

Protein Summary

• Protein general information: Q9NZI6  
  • Name: Transcription factor CP2 like protein 1 (CP2 related transcriptional repressor 1) (CRTR 1) (Transcription factor LBP 9)
  • Length: 479  
  • Mass: 54627
  • Tissue specificity: Highly expressed in placental JEG-3 cells and very low levels of expression in non-steroidogenic cells. No expression was seen in adrenal NCI-H295A cells or in adrenal tissue. {ECO
• Sequence:

  MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENEARLPPLQYVLCAATSPAVKLHEETLTYLNQGQSY
  EIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEHQQLEGWRWSRPGDRILDIDIPLSVGILDPRASPTQL
  NAVEFLWDPAKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNENGEYTEHLHSASCQIKVFKPKGADR
  KQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVAYQVNSAPSPSYNGSPNSFGLGEGNASPTHPVEALPV
  GSDHLLPSASIQDAQQWLHRNRFSQFCRLFASFSGADLLKMSRDDLVQICGPADGIRLFNAIKGRNVRPKMTIYV
  CQELEQNRVPLQQKRDGSGDSNLSVYHAIFLEELTTLELIEKIANLYSISPQHIHRVYRQGPTGIHVVVSNEMVQ
  NFQDESCFVLSTIKAESNDGYHIILKCGL

• Structural information:
  • Interpro: IPR007604  IPR013761  IPR041418  IPR040167  IPR037598  
  • CDD: cd09590
  • STRING: ENSP00000263707
• Other Databases: GeneCards:  TFCP2L1  Malacards:  TFCP2L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0003700	DNA-binding transcription factor activity	IBA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IBA	biological process
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0008340	determination of adult lifespan	IEA	biological process
GO:0007431	salivary gland development	IEA	biological process
GO:0000902	cell morphogenesis	IEA	biological process
GO:0045927	positive regulation of growth	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0007028	cytoplasm organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0002070	epithelial cell maturation	IEA	biological process
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)