• Gene id: 2983

Gene Summary

• Gene Symbol: GUCY1B1   Gene   UCSC   Ensembl
• Aliases: GC-S-beta-1, GC-SB3, GUC1B3, GUCB3, GUCSB3, GUCY1B3
• Gene name: guanylate cyclase 1 soluble subunit beta 1
• Alternate names: guanylate cyclase soluble subunit beta-1, GCS-beta-1, GCS-beta-3, guanylate cyclase 1, soluble, beta 3, guanylate cyclase soluble subunit beta-3, soluble guanylate cyclase small subunit,
• Gene location: 4q32.1 (155759020: 155807810)     Exons: 5     NC_000004.12
• Gene summary(Entrez): This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for
• OMIM: 139397

Protein Summary

• Protein general information: Q02153  
  • Name: Guanylate cyclase soluble subunit beta 1 (GCS beta 1) (EC 4.6.1.2) (Guanylate cyclase soluble subunit beta 3) (GCS beta 3) (Soluble guanylate cyclase small subunit)
  • Length: 619  
  • Mass: 70514
  • Tissue specificity: Detected in brain cortex and cerebellum (at protein level). {ECO
• Sequence:

  MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFF
  VFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGII
  KTVAQQIHGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDR
  DLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
  ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDR
  LQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLL
  NDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHT
  GEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
  VWFLSRKNTGTEETKQDDD

• Structural information:
  • Protein Domains: (421..55-)
    (/note="Guanylate-cyclase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00099"-)
  • Interpro: IPR001054  IPR018297  IPR038158  IPR011644  IPR011645   IPR042463  IPR024096  IPR029787  
  • Prosite: PS00452 PS50125
  • PDB: 2WZ1 3UVJ 4NI2 5MNW 6JT0 6JT1 6JT2
  • PDBsum: 2WZ1 3UVJ 4NI2 5MNW 6JT0 6JT1 6JT2
  • STRING: ENSP00000264424
• Other Databases: GeneCards:  GUCY1B1  Malacards:  GUCY1B1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0099555	trans-synaptic signaling by nitric oxide, modulating synaptic transmission	IBA	biological process
GO:0019934	cGMP-mediated signaling	IBA	biological process
GO:0048786	presynaptic active zone	IBA	cellular component
GO:0006182	cGMP biosynthetic process	IDA	biological process
GO:0004383	guanylate cyclase activity	IDA	molecular function
GO:0008074	guanylate cyclase complex, soluble	IDA	cellular component
GO:0020037	heme binding	ISS	molecular function
GO:0071732	cellular response to nitric oxide	ISS	biological process
GO:0038060	nitric oxide-cGMP-mediated signaling pathway	ISS	biological process
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0006182	cGMP biosynthetic process	IEA	biological process
GO:0020037	heme binding	IEA	molecular function
GO:0009190	cyclic nucleotide biosynthetic process	IEA	biological process
GO:0016849	phosphorus-oxygen lyase activity	IEA	molecular function
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0006182	cGMP biosynthetic process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004383	guanylate cyclase activity	TAS	molecular function
GO:0038023	signaling receptor activity	TAS	molecular function
GO:0007263	nitric oxide mediated signal transduction	TAS	biological process
GO:0008015	blood circulation	TAS	biological process
GO:0008074	guanylate cyclase complex, soluble	TAS	cellular component
GO:0004383	guanylate cyclase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04022	cGMP-PKG signaling pathway
hsa00230	Purine metabolism
hsa04921	Oxytocin signaling pathway
hsa04270	Vascular smooth muscle contraction
hsa04611	Platelet activation
hsa04713	Circadian entrainment
hsa04970	Salivary secretion
hsa04540	Gap junction
hsa04924	Renin secretion
hsa04730	Long-term depression

Diseases

Associated diseases	References
Alzheimer's disease	PMID:15571982
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)