• Gene id: 2981

Gene Summary

• Gene Symbol: GUCA2B   Gene   UCSC   Ensembl
• Aliases: GCAP-II, UGN
• Gene name: guanylate cyclase activator 2B
• Alternate names: guanylate cyclase activator 2B, prepro-uroguanylin, uroguanylin,
• Gene location: 1p34.2 (42153409: 42155819)     Exons: 3     NC_000001.11
• Gene summary(Entrez): This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products, including uroguanylin, a member of the guanylin family of peptides and an endogenous ligand of the guanylate cyclase-C receptor. Binding of this pep
• OMIM: 194549

Protein Summary

• Protein general information: Q16661  
  • Name: Guanylate cyclase activator 2B [Cleaved into: Guanylate cyclase C activating peptide 2 (Guanylate cyclase C activating peptide II) (GCAP II); Uroguanylin (UGN)]
  • Length: 112  
  • Mass: 12069
  • Tissue specificity: Stomach and intestine.
• Sequence:

  MGCRAASGLLPGVAVVLLLLLQSTQSVYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQD
  LQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

• Structural information:
  • Interpro: IPR000879  IPR036382  
  • PDB: 1UYA 1UYB
  • PDBsum: 1UYA 1UYB
  • STRING: ENSP00000361662
• Other Databases: GeneCards:  GUCA2B  Malacards:  GUCA2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030250	guanylate cyclase activator activity	IBA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0030250	guanylate cyclase activator activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008048	calcium sensitive guanylate cyclase activator activity	TAS	molecular function
GO:0007588	excretion	TAS	biological process
GO:0007586	digestion	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045776	negative regulation of blood pressure	IEA	biological process
GO:0007588	excretion	IEA	biological process
GO:0019934	cGMP-mediated signaling	IEA	biological process
GO:0007589	body fluid secretion	IEA	biological process
GO:0001750	photoreceptor outer segment	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0031284	positive regulation of guanylate cyclase activity	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881