• Gene id: 29802

Gene Summary

• Gene Symbol: VPREB3   Gene   UCSC   Ensembl
• Aliases: 8HS20, N27C7-2
• Gene name: V-set pre-B cell surrogate light chain 3
• Alternate names: pre-B lymphocyte protein 3, pre-B lymphocyte 3, pre-B lymphocyte gene 3,
• Gene location: 22q11 (23754424: 23752742)     Exons: 2     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is the human ortholog of the mouse VpreB3 (8HS20) protein, is thought to be involved in B-cell maturation, and may play a role in assembly of the pre-B cell receptor (pre-BCR). While the role of this protein in B-cell deve
• OMIM: 607434

Protein Summary

• Protein general information: Q9UKI3  
  • Name: Pre B lymphocyte protein 3 (N27C7 2) (Protein VPreB3)
  • Length: 123  
  • Mass: 13710
  • Tissue specificity: Expressed in B-cell precursors. Expressed in fetal liver, bone marrow, spleen and lymph node.
• Sequence:

  MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQRAGSAPRYLLYYRSEE
  DHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYGFSP

• Structural information:
  • Protein Domains: (21..12-)
    (/note="Ig-like"-)
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000248948
• Other Databases: GeneCards:  VPREB3  Malacards:  VPREB3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0002377	immunoglobulin production	IBA	biological process
GO:0006955	immune response	IBA	biological process
GO:0005783	endoplasmic reticulum	NAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0050900	leukocyte migration	TAS	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R