• Gene id: 29800

Gene Summary

• Gene Symbol: ZDHHC1   Gene   UCSC   Ensembl
• Aliases: C16orf1, DHHC-1, HSU90653, ZNF377
• Gene name: zinc finger DHHC-type containing 1
• Alternate names: palmitoyltransferase ZDHHC1, probable palmitoyltransferase ZDHHC1, DHHC domain-containing cysteine-rich protein 1, zinc finger DHHC domain-containing protein 1, zinc finger protein 377, zinc finger, DHHC domain containing 1,
• Gene location: 16q22.1 (67416493: 67394151)     Exons: 12     NC_000016.10
• OMIM: 191305

Protein Summary

• Protein general information: Q8WTX9  
  • Name: Palmitoyltransferase ZDHHC1 (EC 2.3.1.225) (DHHC domain containing cysteine rich protein 1) (Zinc finger DHHC domain containing protein 1) (DHHC 1) (Zinc finger protein 377)
  • Length: 485  
  • Mass: 54818
  • Tissue specificity: Widely expressed with significant expression in heart, brain, placenta, lung, liver, kidney, testis, thymus and small intestine (PubMed
• Sequence:

  MYKMNICNKPSNKTAPEKSVWTAPAQPSGPSPELQGQRSRRNGWSWPPHPLQIVAWLLYLFFAVIGFGILVPLLP
  HHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHC
  SACNKCVCGFDHHCKWLNNCVGERNYRLFLHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNRHFEVLKNHTD
  VWFVFLPAAPVETQAPAILALAALLILLGLLSTALLGHLLCFHIYLMWHKLTTYEYIVQHRPPQEAKGVHRELES
  CPPKMRPIQEMEFYMRTFRHMRPEPPGQAGPAAVNAKHSRPASPDPTPGRRDCAGPPVQVEWDRKKPLPWRSPLL
  LLAMWGPQAPPCLCRKRGRGACIKCERLRPRIRRRGLGPPAAAPARRRIPRTPALCTPLALPAPTTRRRQSPWTR
  FQWRRRAWAAPLWPPRGAGADSPRWRGRRVRPPFS

• Structural information:
  • Protein Domains: (134..18-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000340299
• Other Databases: GeneCards:  ZDHHC1  Malacards:  ZDHHC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0140374	antiviral innate immune response	IMP	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032461	positive regulation of protein oligomerization	IEA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IEA	biological process
GO:1905668	positive regulation of protein localization to endosome	IEA	biological process
GO:0140374	antiviral innate immune response	IEA	biological process
GO:0018345	protein palmitoylation	IEA	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0010008	endosome membrane	IEA	cellular component
GO:0002230	positive regulation of defense response to virus by host	IEA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0016409	palmitoyltransferase activity	IDA	molecular function
GO:0018345	protein palmitoylation	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003677	DNA binding	NAS	molecular function

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray