• Gene id: 29799

Gene Summary

• Gene Symbol: YPEL1   Gene   UCSC   Ensembl
• Aliases: FKSG3
• Gene name: yippee like 1
• Alternate names: protein yippee-like 1, DiGeorge syndrome-related protein,
• Gene location: 22q11.21-q11.22 (21735793: 21697535)     Exons: 5     NC_000022.11
• Gene summary(Entrez): This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division. [provided by RefSeq, Feb 2015]
• OMIM: 608082

Protein Summary

• Protein general information: O60688  
  • Name: Protein yippee like 1
  • Length: 119  
  • Mass: 13575
• Sequence:

  MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTGLHAVA
  DIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE

• Structural information:
  • Protein Domains: (19..11-)
    (/note="Yippee-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01128"-)
  • Interpro: IPR034751  IPR004910  IPR039058  
  • Prosite: PS51792
  • STRING: ENSP00000342832
• Other Databases: GeneCards:  YPEL1  Malacards:  YPEL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R