• Gene id: 29796

Gene Summary

• Gene Symbol: UQCR10   Gene   UCSC   Ensembl
• Aliases: HSPC051, HSPC119, HSPC151, QCR9, UCCR7.2, UCRC
• Gene name: ubiquinol-cytochrome c reductase, complex III subunit X
• Alternate names: cytochrome b-c1 complex subunit 9, cytochrome C1, nonheme 7kDa protein, cytochrome c1 non-heme 7 kDa protein, ubiquinol-cytochrome c reductase complex (7.2 kD), ubiquinol-cytochrome c reductase complex 7.2 kDa protein, ubiquinol-cytochrome c reductase, complex,
• Gene location: 22q12.2 (29767368: 29770412)     Exons: 2     NC_000022.11
• Gene summary(Entrez): UCRC is a subunit of mitochondrial complex III (ubiquinol-cytochrome c reductase; EC 1.10.2.2), which forms the middle segment of the respiratory chain of the inner mitochondrial membrane (Schagger et al., 1995 [PubMed 8592474]).[supplied by OMIM, Mar 200

Protein Summary

• Protein general information: Q9UDW1  
  • Name: Cytochrome b c1 complex subunit 9 (Complex III subunit 9) (Complex III subunit X) (Cytochrome c1 non heme 7 kDa protein) (Ubiquinol cytochrome c reductase complex 7.2 kDa protein)
  • Length: 63  
  • Mass: 7308
• Sequence:

  MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

• Structural information:
  • Interpro: IPR008027  IPR036656  
  • PDB: 5XTE 5XTH 5XTI
  • PDBsum: 5XTE 5XTH 5XTI
  • STRING: ENSP00000332887
• Other Databases: GeneCards:  UQCR10  Malacards:  UQCR10

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0034551	mitochondrial respiratory chain complex III assembly	IBA	biological process
GO:0005750	mitochondrial respiratory chain complex III	IBA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IBA	biological process
GO:0009060	aerobic respiration	IBA	biological process
GO:0005750	mitochondrial respiratory chain complex III	IEA	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	IEA	biological process
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070469	respirasome	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	TAS	biological process
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0008121	ubiquinol-cytochrome-c reductase activity	NAS	molecular function
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)