• Gene id: 29789

Gene Summary

• Gene Symbol: OLA1   Gene   UCSC   Ensembl
• Aliases: DOC45, GBP45, GTBP9, GTPBP9, PTD004
• Gene name: Obg like ATPase 1
• Alternate names: obg-like ATPase 1, DNA damage-regulated overexpressed in cancer 45 protein, GTP-binding protein 9 (putative), GTP-binding protein PTD004, homologous yeast-44.2 protein,
• Gene location: 2q31.1 (174248531: 174072446)     Exons: 11     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the GTPase protein family. The encoded protein interacts with breast cancer-associated gene 1 (BRCA1) and BRCA1-associated RING domain protein (BARD1), and is involved in centrosome regulation. Overexpression of this gene has
• OMIM: 611175

Protein Summary

• Protein general information: Q9NTK5  
  • Name: Obg like ATPase 1 (DNA damage regulated overexpressed in cancer 45) (DOC45) (GTP binding protein 9)
  • Length: 396  
  • Mass: 44744
  • Tissue specificity: Expressed in all tissues tested but its expression is more abundant in testis, liver, lung, and brain. Overexpressed in several malignancies, including cancers of the colon, rectum, ovary, lung, stomach, and uterus.
• Sequence:

  MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPNESRVPVPDERFDFLC
  QYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFEDDDITHVEGSVDPIRDIEIIHE
  ELQLKDEEMIGPIIDKLEKVAVRGGDKKLKPEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPM
  VYLVNLSEKDYIRKKNKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGF
  AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSENAVKAAGKYRQQGRNY
  IVEDGDIIFFKFNTPQQPKKK

• Structural information:
  • Protein Domains: (23..28-)
    (/note="OBG-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01047-)
    (304..38-)
    (/note="TGS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01228"-)
  • Interpro: IPR004396  IPR012675  IPR031167  IPR006073  IPR027417   IPR012676  IPR023192  IPR013029  IPR041706  
  • Prosite: PS51710 PS51880
  • CDD: cd04867 cd01900
  • PDB: 2OHF
  • PDBsum: 2OHF
  • DIP: 34591
  • STRING: ENSP00000284719
• Other Databases: GeneCards:  OLA1  Malacards:  OLA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005524	ATP binding	IDA	molecular function
GO:0016887	ATPase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0002576	platelet degranulation	TAS	biological process
GO:0031093	platelet alpha granule lumen	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046034	ATP metabolic process	IDA	biological process
GO:0016887	ATPase activity	IDA	molecular function
GO:0045296	cadherin binding	HDA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043022	ribosome binding	IEA	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0043023	ribosomal large subunit binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016887	ATPase activity	IEA	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881