• Gene id: 29781

Gene Summary

• Gene Symbol: NCAPH2   Gene   UCSC   Ensembl
• Aliases: CAPH2
• Gene name: non-SMC condensin II complex subunit H2
• Alternate names: condensin-2 complex subunit H2, CAP-H2 subunit of the condensin II complex, CTA-384D8.36, chromosome-associated protein H2, kleisin beta,
• Gene location: 22q13.33 (100732136: 100671963)     Exons: 22     NC_000023.11
• Gene summary(Entrez): This gene encodes one of the non-SMC subunits of the condensin II complex. This complex plays an essential role in mitotic chromosome assembly. Alternate splicing of this gene results in multiple transcript variants.[provided by RefSeq, May 2010]
• OMIM: 611230

Protein Summary

• Protein general information: Q6IBW4  
  • Name: Condensin 2 complex subunit H2 (Chromosome associated protein H2) (hCAP H2) (Kleisin beta) (Non SMC condensin II complex subunit H2)
  • Length: 605  
  • Mass: 68227
• Sequence:

  MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLIQGSACVYSKKVEYLY
  SLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLSLDDFPDSRTNVDLKNDQTPSEVLIIPLLPM
  ALVAPDEMEKNNNPLYSRQGEVLASRKDFRMNTCVPHPRGAFMLEPEGMSPMEPAGVSPMPGTQKDTGRTEEQPM
  EVSVCRSPVPALGFSQEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPKESRSPQQSAALPRRYMLRER
  EGAPEPASCVKETPDPWQSLDPFDSLESKPFKKGRPYSVPPCVEEALGQKRKRKGAAKLQDFHQWYLAAYADHAD
  SRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPAEEDHLEDSLEDLGAADDFLEPEEYMEPEGA
  DPREAADLDAVPMSLSYEELVRRNVELFIATSQKFVQETELSQRIRDWEDTVQPLLQEQEQHVPFDIHTYGDQLV
  SRFPQLNEWCPFAELVAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEMAVDTMSLRLLTHQRAHKRFQTYAAP
  SMAQP

• Structural information:
  • Interpro: IPR031737  IPR031719  IPR009378  IPR031739  
  • DIP: 43901
  • STRING: ENSP00000299821
• Other Databases: GeneCards:  NCAPH2  Malacards:  NCAPH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000793	condensed chromosome	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0051276	chromosome organization	IBA	biological process
GO:0051306	mitotic sister chromatid separation	IBA	biological process
GO:0000796	condensin complex	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0010032	meiotic chromosome condensation	IBA	biological process
GO:0007076	mitotic chromosome condensation	ISS	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0030261	chromosome condensation	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051306	mitotic sister chromatid separation	IEA	biological process
GO:0033077	T cell differentiation in thymus	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000793	condensed chromosome	IEA	cellular component
GO:0051309	female meiosis chromosome separation	IEA	biological process
GO:0010032	meiotic chromosome condensation	IEA	biological process
GO:0007143	female meiotic nuclear division	IEA	biological process
GO:0007076	mitotic chromosome condensation	IEA	biological process
GO:0000796	condensin complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq