Male Infertility Database

Search Result

Gene id

2967

Gene Summary Protein Summary Gene ontology KEGG pathways Diseases PubMed

Gene Summary

Gene Symbol

GTF2H3 Gene UCSC Ensembl

Aliases

BTF2, P34, TFB4, TFIIH

Gene name

general transcription factor IIH subunit 3

Alternate names

general transcription factor IIH subunit 3, TFIIH basal transcription factor complex p34 subunit, basic transcription factor 2 34 kDa subunit, general transcription factor IIH, polypeptide 3, 34kDa,

Gene location

12q24.31 (123633738: 123662603) Exons: 13 NC_000012.12

Gene summary(Entrez)

This gene encodes a member of the TFB4 family. The encoded protein is a subunit of the core-TFIIH basal transcription factor and localizes to the nucleus. The encoded protein is involved in RNA transcription by RNA polymerase II and nucleotide excision re

OMIM

601750

Protein Summary

Protein general information

Q13889

Name: General transcription factor IIH subunit 3 (Basic transcription factor 2 34 kDa subunit) (BTF2 p34) (General transcription factor IIH polypeptide 3) (TFIIH basal transcription factor complex p34 subunit)

Length: 308 Mass: 34378

Sequence

MVSDEDELNLLVIVVDANPIWWGKQALKESQFTLSKCIDAVMVLGNSHLFMNRSNKLAVIASHIQESRFLYPGKN
GRLGDFFGDPGNPPEFNPSGSKDGKYELLTSANEVIVEEIKDLMTKSDIKGQHTETLLAGSLAKALCYIHRMNKE
VKDNQEMKSRILVIKAAEDSALQYMNFMNVIFAAQKQNILIDACVLDSDSGLLQQACDITGGLYLKVPQMPSLLQ
YLLWVFLPDQDQRSQLILPPPVHVDYRAACFCHRNLIEIGYVCSVCLSIFCNFSPICTTCETAFKISLPPVLKAK
KKKLKVSA

Structural information

Interpro:	IPR004600 IPR036465
PDB:	5IVW 5IY6 5IY7 5IY8 5IY9 5O85 5OF4 6NMI 6O9L 6O9M 6RO4
PDBsum:	5IVW 5IY6 5IY7 5IY8 5IY9 5O85 5OF4 6NMI 6O9L 6O9M 6RO4
DIP:	787
STRING:	ENSP00000445162

Other Databases

GeneCards: GTF2H3 Malacards: GTF2H3

Gene ontology

Expand All | Collapse All

GO accession	Term name	Evidence code	Go category
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0008353	RNA polymerase II CTD hep tapeptide repeat kinase a ctivity	IBA	contributes to
GO:0008094	DNA-dependent ATPase acti vity	IBA	contributes to
GO:0006289	nucleotide-excision repai r	IBA	biological process
GO:0005675	transcription factor TFII H holo complex	IBA	cellular component
GO:0070816	phosphorylation of RNA po lymerase II C-terminal do main	IBA	biological process
GO:0000439	transcription factor TFII H core complex	IBA	cellular component
GO:0006366	transcription by RNA poly merase II	IDA	biological process
GO:0005675	transcription factor TFII H holo complex	IDA	cellular component
GO:0006366	transcription by RNA poly merase II	IDA	biological process
GO:0005669	transcription factor TFII D complex	IDA	cellular component
GO:0000438	core TFIIH complex portio n of holo TFIIH complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0097550	transcription preinitiati on complex	IDA	cellular component
GO:0006289	nucleotide-excision repai r	IEA	biological process
GO:0000439	transcription factor TFII H core complex	IEA	cellular component
GO:0006355	regulation of transcripti on, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006281	DNA repair	TAS	biological process
GO:0006283	transcription-coupled nuc leotide-excision repair	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0006368	transcription elongation from RNA polymerase II pr omoter	TAS	biological process
GO:0033683	nucleotide-excision repai r, DNA incision	TAS	biological process
GO:0000717	nucleotide-excision repai r, DNA duplex unwinding	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006293	nucleotide-excision repai r, preincision complex st abilization	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006294	nucleotide-excision repai r, preincision complex as sembly	TAS	biological process
GO:0006295	nucleotide-excision repai r, DNA incision, 3'-to le sion	TAS	biological process
GO:0006296	nucleotide-excision repai r, DNA incision, 5'-to le sion	TAS	biological process
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006361	transcription initiation from RNA polymerase I pro moter	TAS	biological process
GO:0006362	transcription elongation from RNA polymerase I pro moter	TAS	biological process
GO:0006363	termination of RNA polyme rase I transcription	TAS	biological process
GO:0006366	transcription by RNA poly merase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II pr omoter	TAS	biological process
GO:0006370	7-methylguanosine mRNA ca pping	TAS	biological process
GO:0070911	global genome nucleotide- excision repair	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0047485	protein N-terminus bindin g	IPI	molecular function
GO:0047485	protein N-terminus bindin g	IPI	molecular function
GO:0047485	protein N-terminus bindin g	IPI	molecular function

KEGG pathways

Expand All | Collapse All

Pathway id	Pathway name
hsa05203	Viral carcinogenesis
hsa03022	Basal transcription factors
hsa03420	Nucleotide excision repair

Diseases

Expand All | Collapse All

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic failure	MIK: 29966603

PubMed references

Expand All | Collapse All

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes	Abstract
29966603	Spermatoge nic failur e	12chr: 124144111 T>C, p.Ser222Pro	Turkish	4 infertile bro thers in this f amily diagnosed with oligozoos permia and azoo spermia	Male infertility	NGS	Show abstract
21674046	Aberrant C pGs in Low Motility Sperm			18	Male infertility	GSE26881	Show abstract

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Expand All | Collapse All

Diseases

Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

Male Infertility knowledgebase

A repository with genes crucial for male fertility

Search Result

Gene Summary

Protein Summary

Gene ontology

Expand All | Collapse All

KEGG pathways Expand All | Collapse All

Expand All | Collapse All

Diseases Expand All | Collapse All

Expand All | Collapse All

PubMed references

Expand All | Collapse All

KEGG pathways

Expand All | Collapse All

Diseases

Expand All | Collapse All