• Gene id: 2961

Gene Summary

• Gene Symbol: GTF2E2   Gene   UCSC   Ensembl
• Aliases: FE, TF2E2, TFIIE-B, TTD6
• Gene name: general transcription factor IIE subunit 2
• Alternate names: transcription initiation factor IIE subunit beta, TFIIE beta subunit, TFIIE-beta, general transcription factor IIE, polypeptide 2, beta 34kDa,
• Gene location: 8p12 (30658240: 30578317)     Exons: 13     NC_000008.11
• Gene summary(Entrez): The general transcription factor IIE (TFIIE) is part of the RNA polymerase II transcription initiation complex, recruiting TFIIH and being essential for promoter clearance by RNA polymerase II. TFIIE is a heterodimer (and sometimes heterotetramer) of alph
• OMIM: 191041

Protein Summary

• Protein general information: P29084  
  • Name: Transcription initiation factor IIE subunit beta (TFIIE beta) (General transcription factor IIE subunit 2)
  • Length: 291  
  • Mass: 33044
• Sequence:

  MDPSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKF
  GVLAKIVNYMKTRHQRGDTHPLTLDEILDETQHLDIGLKQKQWLMTEALVNNPKIEVIDGKYAFKPKYNVRDKKA
  LLRLLDQHDQRGLGGILLEDIEEALPNSQKAVKALGDQILFVNRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTV
  DSMDEEKIEEYLKRQGISSMQESGPKKVAPIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITSSK

• Structural information:
  • Interpro: IPR040501  IPR016656  IPR003166  IPR036388  IPR036390  
  • Prosite: PS51351
  • CDD: cd07977
  • PDB: 1D8J 1D8K 5GPY 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6O9L
  • PDBsum: 1D8J 1D8K 5GPY 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 6O9L
  • DIP: 716
  • STRING: ENSP00000348168
• Other Databases: GeneCards:  GTF2E2  Malacards:  GTF2E2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0006367	transcription initiation from RNA polymerase II promoter	IBA	biological process
GO:0005673	transcription factor TFIIE complex	IBA	cellular component
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005673	transcription factor TFIIE complex	IEA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05203	Viral carcinogenesis
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Trichothiodystrophy	KEGG:H00866
Trichothiodystrophy	KEGG:H00866
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881