• Gene id: 2959

Gene Summary

• Gene Symbol: GTF2B   Gene   UCSC   Ensembl
• Aliases: TF2B, TFIIB
• Gene name: general transcription factor IIB
• Alternate names: transcription initiation factor IIB, RNA polymerase II transcription factor IIB, S300-II, general transcription factor TFIIB,
• Gene location: 1p22.2 (88891943: 88852632)     Exons: 9     NC_000001.11
• Gene summary(Entrez): This gene encodes the general transcription factor IIB, one of the ubiquitous factors required for transcription initiation by RNA polymerase II. The protein localizes to the nucleus where it forms a complex (the DAB complex) with transcription factors II
• OMIM: 189963

Protein Summary

• Protein general information: Q00403  
  • Name: Transcription initiation factor IIB (EC 2.3.1.48) (General transcription factor TFIIB) (S300 II)
  • Length: 316  
  • Mass: 34833
  • Tissue specificity: Expressed in the inner cell mass forming the embryoblast (PubMed
• Sequence:

  MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDPSRVGDSQNPLL
  SDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKS
  LKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLP
  KQVQMAATHIARKAVELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
  PTDFKFDTPVDKLPQL

• Structural information:
  • Interpro: IPR013763  IPR036915  IPR000812  IPR023486  IPR013150   IPR013137  
  • Prosite: PS00782 PS51134
  • CDD: cd00043
  • PDB: 1C9B 1DL6 1RLY 1RO4 1TFB 1VOL 2PHG 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 5WH1 6O9L
  • PDBsum: 1C9B 1DL6 1RLY 1RO4 1TFB 1VOL 2PHG 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 5WH1 6O9L
  • DIP: 1077
  • STRING: ENSP00000359531
• Other Databases: GeneCards:  GTF2B  Malacards:  GTF2B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0001174	transcriptional start site selection at RNA polymerase II promoter	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0008134	transcription factor binding	IBA	molecular function
GO:0097550	transcription preinitiation complex	IBA	cellular component
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IBA	molecular function
GO:0001139	RNA polymerase II complex recruiting activity	IBA	molecular function
GO:0006352	DNA-templated transcription, initiation	IBA	biological process
GO:0017025	TBP-class protein binding	IBA	molecular function
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IDA	molecular function
GO:0001046	core promoter sequence-specific DNA binding	IDA	molecular function
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IDA	molecular function
GO:0008270	zinc ion binding	IDA	molecular function
GO:0001046	core promoter sequence-specific DNA binding	IDA	molecular function
GO:0016407	acetyltransferase activity	IDA	molecular function
GO:0006473	protein acetylation	IDA	biological process
GO:1990841	promoter-specific chromatin binding	IDA	molecular function
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0090575	RNA polymerase II transcription regulator complex	IDA	cellular component
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0051123	RNA polymerase II preinitiation complex assembly	IDA	biological process
GO:0043923	positive regulation by host of viral transcription	IDA	biological process
GO:1990841	promoter-specific chromatin binding	IDA	molecular function
GO:0032993	protein-DNA complex	IDA	cellular component
GO:0090575	RNA polymerase II transcription regulator complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0005694	chromosome	IDA	cellular component
GO:0000993	RNA polymerase II complex binding	IDA	molecular function
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0090575	RNA polymerase II transcription regulator complex	IMP	cellular component
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0051123	RNA polymerase II preinitiation complex assembly	IMP	biological process
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0006366	transcription by RNA polymerase II	IMP	biological process
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0060261	positive regulation of transcription initiation from RNA polymerase II promoter	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0001174	transcriptional start site selection at RNA polymerase II promoter	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990114	RNA polymerase II core complex assembly	IMP	biological process
GO:1990114	RNA polymerase II core complex assembly	IMP	biological process
GO:0006352	DNA-templated transcription, initiation	IEA	biological process
GO:0017025	TBP-class protein binding	IEA	molecular function
GO:0070897	transcription preinitiation complex assembly	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050434	positive regulation of viral transcription	IMP	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990841	promoter-specific chromatin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0016573	histone acetylation	IEA	biological process
GO:1904798	positive regulation of core promoter binding	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0051123	RNA polymerase II preinitiation complex assembly	IDA	biological process
GO:0097550	transcription preinitiation complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046966	thyroid hormone receptor binding	IPI	molecular function
GO:0008134	transcription factor binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05203	Viral carcinogenesis
hsa05017	Spinocerebellar ataxia
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray