• Gene id: 2958

Gene Summary

• Gene Symbol: GTF2A2   Gene   UCSC   Ensembl
• Aliases: HsT18745, T18745, TF2A2, TFIIA, TFIIA-12, TFIIA-gamma, TFIIAS
• Gene name: general transcription factor IIA subunit 2
• Alternate names: transcription initiation factor IIA subunit 2, TFIIA gamma subunit, TFIIA p12 subunit, general transcription factor IIA 2, general transcription factor IIA, 2, 12kDa, transcription initiation factor IIA gamma chain,
• Gene location: 15q22.2 (81035130: 81117433)     Exons: 23     NC_000017.11
• Gene summary(Entrez): Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and the general initiation factors TFIIA, TFIIB (MIM 189963), TFIID (MIM 313650), TFIIE (MIM 189962), TFIIF (MIM 18
• OMIM: 600519

Protein Summary

• Protein general information: P52657  
  • Name: Transcription initiation factor IIA subunit 2 (General transcription factor IIA subunit 2) (TFIIA p12 subunit) (TFIIA 12) (TFIIAS) (Transcription initiation factor IIA gamma chain) (TFIIA gamma)
  • Length: 109  
  • Mass: 12457
• Sequence:

  MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFV
  LNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE

• Structural information:
  • Interpro: IPR009083  IPR009088  IPR003194  IPR015871  IPR015872  
  • CDD: cd10014 cd10145
  • PDB: 1NVP 5FUR 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 5M4S 6MZM 6O9L
  • PDBsum: 1NVP 5FUR 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 5M4S 6MZM 6O9L
  • DIP: 40648
  • STRING: ENSP00000379372
• Other Databases: GeneCards:  GTF2A2  Malacards:  GTF2A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0005672	transcription factor TFIIA complex	IBA	cellular component
GO:0017025	TBP-class protein binding	IBA	molecular function
GO:0051123	RNA polymerase II preinitiation complex assembly	IBA	biological process
GO:0003713	transcription coactivator activity	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0051091	positive regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005672	transcription factor TFIIA complex	IEA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0001103	RNA polymerase II repressing transcription factor binding	IEA	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005672	transcription factor TFIIA complex	IDA	cellular component
GO:0005672	transcription factor TFIIA complex	IDA	cellular component
GO:0005672	transcription factor TFIIA complex	IDA	cellular component
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	IDA	biological process
GO:0051123	RNA polymerase II preinitiation complex assembly	IDA	biological process
GO:0051123	RNA polymerase II preinitiation complex assembly	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0030054	cell junction	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05203	Viral carcinogenesis
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray