• Gene id: 2957

Gene Summary

• Gene Symbol: GTF2A1   Gene   UCSC   Ensembl
• Aliases: TF2A1, TFIIA, TFIIA-42, TFIIAL
• Gene name: general transcription factor IIA subunit 1
• Alternate names: transcription initiation factor IIA subunit 1, TFIIA alpha, p55, TFIIA alpha/beta subunits, general transcription factor IIA 1, general transcription factor IIA, 1, 19/37kDa, glucose regulated protein, 58kD pseudogene, transcription initiation factor TFIIA 42 k,
• Gene location: 14q31.1 (81221389: 81175451)     Exons: 5     NC_000014.9
• Gene summary(Entrez): Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these facto
• OMIM: 600520

Protein Summary

• Protein general information: P52655  
  • Name: Transcription initiation factor IIA subunit 1 (General transcription factor IIA subunit 1) (TFIIAL) (Transcription initiation factor TFIIA 42 kDa subunit) (TFIIA 42) [Cleaved into: Transcription initiation factor IIA alpha chain (TFIIA p35 subunit); Trans
  • Length: 376  
  • Mass: 41514
• Sequence:

  MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQVQQQHQ
  PQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVT
  PVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQ
  ILFTGNKTQVIPTTVAAPTPAQAQITATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
  KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAE
  W

• Structural information:
  • Interpro: IPR004855  IPR009088  
  • PDB: 1NVP 5FUR 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 5M4S 6MZM 6O9L
  • PDBsum: 1NVP 5FUR 5IY6 5IY7 5IY8 5IY9 5IYA 5IYB 5IYC 5IYD 5M4S 6MZM 6O9L
  • DIP: 33225
  • STRING: ENSP00000452454
• Other Databases: GeneCards:  GTF2A1  Malacards:  GTF2A1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0000979	RNA polymerase II core promoter sequence-specific DNA binding	IDA	molecular function
GO:0016251	RNA polymerase II general transcription initiation factor activity	IDA	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0005672	transcription factor TFIIA complex	IBA	cellular component
GO:0006366	transcription by RNA polymerase II	IBA	biological process
GO:0005669	transcription factor TFIID complex	IDA	cellular component
GO:0005672	transcription factor TFIIA complex	IEA	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005672	transcription factor TFIIA complex	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0001103	RNA polymerase II repressing transcription factor binding	IEA	molecular function
GO:0017025	TBP-class protein binding	IPI	molecular function
GO:0003677	DNA binding	IDA	molecular function
GO:0008134	transcription factor binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0005672	transcription factor TFIIA complex	IDA	cellular component
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0006366	transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0016251	RNA polymerase II general transcription initiation factor activity	TAS	molecular function
GO:0097550	transcription preinitiation complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05203	Viral carcinogenesis
hsa03022	Basal transcription factors

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)