• Gene id: 2950

Gene Summary

• Gene Symbol: GSTP1   Gene   UCSC   Ensembl
• Aliases: DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
• Gene name: glutathione S-transferase pi 1
• Alternate names: glutathione S-transferase P, GST class-pi, GSTP1-1, deafness, X-linked 7, epididymis secretory protein Li 22, fatty acid ethyl ester synthase III,
• Gene location: 11q13.2 (67583594: 67586652)     Exons: 7     NC_000011.10
• Gene summary(Entrez): Glutathione S-transferases (GSTs) are a family of enzymes that play an important role in detoxification by catalyzing the conjugation of many hydrophobic and electrophilic compounds with reduced glutathione. Based on their biochemical, immunologic, and st
• OMIM: 134660

Protein Summary

• Protein general information: P09211  
  • Name: Glutathione S transferase P (EC 2.5.1.18) (GST class pi) (GSTP1 1)
  • Length: 210  
  • Mass: 23,356
• Sequence:

  MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGR
  TLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQIS
  FADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ

• Structural information:
  • Protein Domains: GST (2-81)
    GST (83-204)
  • Interpro: IPR010987  IPR036282  IPR004045  IPR004046  IPR003082   IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 10GS 11GS 12GS 13GS 14GS 16GS 17GS 18GS 19GS 1AQV 1AQW 1AQX 1EOG 1EOH 1GSS 1KBN 1LBK 1MD3 1MD4 1PGT 1PX6 1PX7 1ZGN 20GS 22GS 2A2R 2A2S 2GSS 2J9H 2PGT 3CSH 3CSI 3CSJ 3DD3 3DGQ 3GSS 3GUS 3HJM 3HJO 3HKR 3IE3 3KM6 3KMN 3KMO 3N9J 3PGT 4GSS 4PGT 5DAK 5DAL 5DCG
  • PDBsum: 10GS 11GS 12GS 13GS 14GS 16GS 17GS 18GS 19GS 1AQV 1AQW 1AQX 1EOG 1EOH 1GSS 1KBN 1LBK 1MD3 1MD4 1PGT 1PX6 1PX7 1ZGN 20GS 22GS 2A2R 2A2S 2GSS 2J9H 2PGT 3CSH 3CSI 3CSJ 3DD3 3DGQ 3GSS 3GUS 3HJM 3HJO 3HKR 3IE3 3KM6 3KMN 3KMO 3N9J 3PGT 4GSS 4PGT 5DAK 5DAL 5DCG
  • STRING: ENSP00000381607
• Other Databases: GeneCards:  GSTP1  Malacards:  GSTP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000302	response to reactive oxygen species	ISS	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0002674	negative regulation of acute inflammatory response	NAS	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0008432	JUN kinase binding	ISS	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0009890	negative regulation of biosynthetic process	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IC	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0019207	kinase regulator activity	ISS	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0032691	negative regulation of interleukin-1 beta production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032872	regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032930	positive regulation of superoxide anion generation	ISS	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0035726	common myeloid progenitor cell proliferation	ISS	biological process
GO:0035730	S-nitrosoglutathione binding	IDA	molecular function
GO:0035731	dinitrosyl-iron complex binding	IDA	molecular function
GO:0035731	dinitrosyl-iron complex binding	IDA	molecular function
GO:0035732	nitric oxide storage	NAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043295	glutathione binding	IEA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0043409	negative regulation of MAPK cascade	NAS	biological process
GO:0043508	negative regulation of JUN kinase activity	IDA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0046689	response to mercury ion	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	ISS	biological process
GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0070026	nitric oxide binding	NAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070664	negative regulation of leukocyte proliferation	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0071460	cellular response to cell-matrix adhesion	IEA	biological process
GO:0071638	negative regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0097057	TRAF2-GSTP1 complex	IDA	cellular component
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0000302	response to reactive oxygen species	ISS	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0002674	negative regulation of acute inflammatory response	NAS	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IEA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0008144	drug binding	IEA	molecular function
GO:0008152	metabolic process	IEA	biological process
GO:0008432	JUN kinase binding	ISS	molecular function
GO:0009636	response to toxic substance	IEA	biological process
GO:0009890	negative regulation of biosynthetic process	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IC	biological process
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0019207	kinase regulator activity	ISS	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0031982	vesicle	IDA	cellular component
GO:0032355	response to estradiol	IEA	biological process
GO:0032691	negative regulation of interleukin-1 beta production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032872	regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032930	positive regulation of superoxide anion generation	ISS	biological process
GO:0033591	response to L-ascorbic acid	IEA	biological process
GO:0035726	common myeloid progenitor cell proliferation	ISS	biological process
GO:0035730	S-nitrosoglutathione binding	IDA	molecular function
GO:0035731	dinitrosyl-iron complex binding	IDA	molecular function
GO:0035731	dinitrosyl-iron complex binding	IDA	molecular function
GO:0035732	nitric oxide storage	NAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0043200	response to amino acid	IEA	biological process
GO:0043295	glutathione binding	IEA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0043409	negative regulation of MAPK cascade	NAS	biological process
GO:0043508	negative regulation of JUN kinase activity	IDA	biological process
GO:0045471	response to ethanol	IEA	biological process
GO:0046689	response to mercury ion	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	ISS	biological process
GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0070026	nitric oxide binding	NAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070664	negative regulation of leukocyte proliferation	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IEA	biological process
GO:0071385	cellular response to glucocorticoid stimulus	IEA	biological process
GO:0071460	cellular response to cell-matrix adhesion	IEA	biological process
GO:0071638	negative regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0097057	TRAF2-GSTP1 complex	IDA	cellular component
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process
GO:0000302	response to reactive oxygen species	ISS	biological process
GO:0000302	response to reactive oxygen species	TAS	biological process
GO:0002674	negative regulation of acute inflammatory response	NAS	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0007417	central nervous system development	TAS	biological process
GO:0008432	JUN kinase binding	ISS	molecular function
GO:0009890	negative regulation of biosynthetic process	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IC	biological process
GO:0019207	kinase regulator activity	ISS	molecular function
GO:0031982	vesicle	IDA	cellular component
GO:0032691	negative regulation of interleukin-1 beta production	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0032872	regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032873	negative regulation of stress-activated MAPK cascade	ISS	biological process
GO:0032930	positive regulation of superoxide anion generation	ISS	biological process
GO:0035726	common myeloid progenitor cell proliferation	ISS	biological process
GO:0035730	S-nitrosoglutathione binding	IDA	molecular function
GO:0035731	dinitrosyl-iron complex binding	IDA	molecular function
GO:0035731	dinitrosyl-iron complex binding	IDA	molecular function
GO:0035732	nitric oxide storage	NAS	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0043409	negative regulation of MAPK cascade	NAS	biological process
GO:0043508	negative regulation of JUN kinase activity	IDA	biological process
GO:0048147	negative regulation of fibroblast proliferation	ISS	biological process
GO:0051771	negative regulation of nitric-oxide synthase biosynthetic process	IDA	biological process
GO:0070026	nitric oxide binding	NAS	molecular function
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070372	regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0070664	negative regulation of leukocyte proliferation	ISS	biological process
GO:0071222	cellular response to lipopolysaccharide	ISS	biological process
GO:0071638	negative regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0097057	TRAF2-GSTP1 complex	IDA	cellular component
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:2001237	negative regulation of extrinsic apoptotic signaling pathway	IDA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05204	Chemical carcinogenesis
hsa05225	Hepatocellular carcinoma
hsa05215	Prostate cancer
hsa05418	Fluid shear stress and atherosclerosis
hsa01524	Platinum drug resistance

Diseases

Associated diseases	References
Astrocytoma	GAD: 21128213
Cancer (thyroid)	GAD: 17158763
Cancer (transitional cell)	GAD: 18199464
Cancer (urologic)	GAD: 18930278
Leukoplakia	GAD: 18507060
Cancer (prostate)	KEGG: H00024
Brill-Symmers disease	GAD: 20029944
Cancer	GAD: 12072547
Cancer (adenocarcinoma)	GAD: 14607333
Cancer (Adenoma)	GAD: 20375710
Cancer (Barrett's esophagus esophageal cancer)	GAD: 17277236
Cancer (basal cell)	GAD: 19800766
Cancer (bladder)	GAD: 15122594
Cancer (brain)	GAD: 17372252
Cancer (cervical)	GAD: 18851872
Cancer (Chronic B-Cell Leukemias)	GAD: 12010828
Cancer (colon)	GAD: 19098406
Cancer (colorectal)	GAD: 16006997
Cancer (endometrial)	GAD: 20381444
Cancer (esophageal)	GAD: 12883749
Cancer (gallbladder)	GAD: 16760134
Cancer (gastric)	GAD: 19506726
Cancer (germinoma)	GAD: 19741569
Cancer (glaucoma)	GAD: 11040079
Cancer (glioma)	GAD: 20391338
Cancer (head and neck)	GAD: 12548461
Cancer (Hepatocellular)	GAD: 20331903
Cancer (kidney)	GAD: 17617661
Cancer (laryngeal)	GAD: 12359356
Cancer (leukemia)	GAD: 15738600
Cancer (liver)	GAD: 17363580
Cancer (lung)	GAD: 12234692
Cancer (lymphoma)	GAD: 15725081
Cancer (melanoma)	GAD: 17342328
Cancer (myeloid leukemia)	GAD: 19811334
Cancer (myeloma)	GAD: 17512053
Cancer (Neuroblastoma)	GAD: 15900216
Cancer (non-melanoma skin cancer)	GAD: 15459020
Cancer (oral)	GAD: 10780269
Cancer (oropharyngeal)	GAD: 12029283
Cancer (ovarian)	GAD: 16710704
Cancer (pancreatic)	GAD: 19786118
Cancer (Papilary)	GAD: 18601742
Cancer (prostate)	GAD: 14719475
Cancer (Squamous cell)	GAD: 18453734
Cancer (Stomach)	GAD: 19595155
Cancer (testicular)	GAD: 18162130
Cancer (breast)	GAD: 12036913
Atherosclerosis	GAD: 19948975
Cardiovascular disease	GAD: 11535248
Hypertension	GAD: 16369102
Blood pressure	GAD: 19590686
Intrauterine growth retardation	GAD: 14665706
Down syndrome	GAD: 19491810
Bronchopulmonary dysplasia	GAD: 14726935
Cystic fibrosis	GAD: 15115915
Cleft defects	GAD: 17608547
Cleft defects	GAD: 17608547
Esophageal atresia	GAD: 20740495
Hepatic Veno-Occlusive disease	GAD: 18641537
Graves disease	GAD: 19903800
Exfoliation syndrome	GAD: 16020292
Glaucoma	GAD: 11040079
Macular degeneration	GAD: 16496253
Eye diseases	GAD: 18447907
Fanconi anemia	GAD: 16173971
Aplastic anemia	GAD: 16079101
Leukopenia	GAD: 17593093
Myelodysplastic syndrome	GAD: 18493876
Sarcoidosis	GAD: 20082271
Neutropenia	GAD: 19074750
Hodgkin disease	GAD: 18768784
Asthma	GAD: 11927838
Asthma	GAD: 11739132
Chronic ulcerative colitis	GAD: 20459366
Systemic lupus erythematosus (SLE)	GAD: 15934438
Crohn's disease	GAD: 12631667
Hypersensitivity	GAD: 14726165
Diabetes	GAD: 18413200
Fatty liver	GAD: 18492019
Obesity	GAD: 19057702
Bone diseases	GAD: 16995867
Dyskinesias	GAD: 20041472
Motor neuron disease	GAD: 15341277
Peripheral nervous system diseases	GAD: 19223573
Alzheimer's disease	GAD: 19141999
Parkinson disease	GAD: 15288444
Arthritis	GAD: 12421093
Cirrhosis	GAD: 16157826
Vestibular diseases	GAD: 18776599
Hearing Loss	GAD: 17228018
Dyspepsia	GAD: 18365908
Schizophrenia	GAD: 12691788
Chronic renal failure	GAD: 21085059
Preeclampsia	GAD: 11751440
Miscarriage	GAD: 19892789
Endometriosis	INFBASE: 24183097
Female infertility	INFBASE: 23141164
Male factor infertility	MIK: 22903474
Azoospermia	MIK: 23450492
Oligoasthenoteratozoospermia	MIK: 23324581
Male factor infertility	MIK: 23450492
Azoospermia	MIK: 25532576
Oligozoospermia	MIK: 25532576
Male factor infertility	MIK: 20686491
Varicocele	MIK: 21546615
Chronic obstructive pulmonary disease (COPD)	GAD: 18550614
Lung disease	GAD: 12153964
Pulmonary fibrosis	GAD: 15923250
Rhinitis	GAD: 17181111
Solar keratosis	GAD: 12485442
Vitiligo	GAD: 19571817
Dermatitis	GAD: 19842992
Connective tissue diseases	GAD: 19527514
Alpha 1-antitrypsin deficiency	GAD: 17690329
Anoxia	GAD: 19017876
Ascorbic acid deficiency	GAD: 19710200
Dysmenorrhea	GAD: 20197727
Emphysema	GAD: 12579334
Encephalopathy	GAD: 17022435
Respiratory distress syndrome	GAD: 18993042
Barrett's esophagus	GAD: 17476458
Cognitive function	GAD: 19057715
Genital diseases	GAD: 19799358
Nephrotic syndrome	GAD: 18594869
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Azoospermia	MIK: 23450492
Oligozoospermia	MIK: 25532576
Male infertility	MIK: 20505681
Oligoasthenoteratozoospermia	MIK: 23324581
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 21546615

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25532576	Idiopathic azoospermia, oligospermia	GSTT1-null and GSTP1 (Ile/Val + Val/Val), GSTP1 variant genotype (Ile/Val + Val/Val)	Chinese	723 (361 men with idiopathic azoospermia, 118 men with idiopathic oligospermia, 234 age-matched healthy fertile male controls)	Male infertility	GSTM1 GSTT1 and GSTP1
23450492	Azoospermia	M1 (-/-) and P1 (Ile/Val or Val/Val) genotype		378 (236 azoospermia patients, 142 healthy fertile male controls)	Male infertility	GSTT1  GSTM1 and GSTP1
23324581	Oligoasthenoteratozoospermia	Ile105Val and Ala114Val		121 (95 infertile men with OAT, 26 controls with normozoospermia)	Male infertility	GSTM1 GSTP1
22903474	Male factor infertility	GSTP1 Ile/Val genotype		2377 (1323 cases, 1054 controls)	Male infertility	GSTM1 GSTT1 and GSTP1
21546615	Varicocele, Male infertility	GSTP1 A/A and A/G+G/G genotypes, GSTT1 null genotypes	Northwe stern C hina	95 (65 infertile men with varicoceles, 30 controls)	Male infertility	GSTM1 GSTT1 and GSTM1/T1
20686491	Idiopathic male infertility	GSTM1 present/null, GSTT1 present/ null, GSTP1 Ile105Val		1617 (862 male infertility cases, 755 controls)	Male infertility	GSTM1 GSTT1 GSTP1
20505681	Idiopathic male infertility	GSTP1 (Ile/Val and Val/Val), GSTM1 or GSTT1null genotypes		332 (166 men suffering from idiopathic oligoasthenoteratozoospermia (OAT), 166 healthy male controls)	Male infertility	GSTM1 GSTT1 and GSTP1
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
26663067	Idiopathic male infertility	SPO11 c.517C>T(rs28368082), A>G transition at nucleotide 313 in the exon 5 of the GSTP1 gene, and the combined genotypes of GSTM1 (-/-), GSTT1 (+/+), GSTP1 (AA) and SPO11 (CT)	Chinese Han	414 (216 idiopathic male infertility cases, 198 normal samples)	Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881