• Gene id: 2949

Gene Summary

• Gene Symbol: GSTM5   Gene   UCSC   Ensembl
• Aliases: GSTM5-5, GTM5
• Gene name: glutathione S-transferase mu 5
• Alternate names: glutathione S-transferase Mu 5, GST class-mu 5, S-(hydroxyalkyl)glutathione lyase M5, epididymis secretory sperm binding protein, glutathione S-alkyltransferase M5, glutathione S-aralkyltransferase M5, glutathione S-aryltransferase M5, glutathione S-transferase ,
• Gene location: 1p13.3 (109711750: 109718267)     Exons: 9     NC_000001.11
• Gene summary(Entrez): Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

Protein Summary

• Protein general information: P46439  
  • Name: Glutathione S transferase Mu 5 (EC 2.5.1.18) (GST class mu 5) (GSTM5 5)
  • Length: 218  
  • Mass: 25675
• Sequence:

  MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNA
  ILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAG
  DKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK

• Structural information:
  • Protein Domains: (2..8-)
    (/note="GST-N-terminal)
    (90..20-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR004046   IPR003081  IPR036249  
  • Prosite: PS50405 PS50404
  • STRING: ENSP00000256593
• Other Databases: GeneCards:  GSTM5  Malacards:  GSTM5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray