• Gene id: 2948

Gene Summary

• Gene Symbol: GSTM4   Gene   UCSC   Ensembl
• Aliases: GSTM4-4, GTM4
• Gene name: glutathione S-transferase mu 4
• Alternate names: glutathione S-transferase Mu 4, GST class-mu 4, GST-Mu2, GTS-Mu2, S-(hydroxyalkyl)glutathione lyase M4, glutathione S-alkyltransferase M4, glutathione S-aralkyltransferase M4, glutathione S-aryltransferase M4, glutathione S-transferase M4, testis tissue sperm-bind,
• Gene location: 1p13.3 (109656075: 109665496)     Exons: 10     NC_000001.11
• Gene summary(Entrez): Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omeg

Protein Summary

• Protein general information: Q03013  
  • Name: Glutathione S transferase Mu 4 (EC 2.5.1.18) (GST class mu 4) (GST Mu2) (GSTM4 4)
  • Length: 218  
  • Mass: 25561
  • Tissue specificity: Expressed in a wide variety of tissues.
• Sequence:

  MSMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNA
  ILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPDFEKLKPEYLEELPTMMQHFSQFLGKRPWFVG
  DKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISRFEGLEKISAYMKSSRFLPKPLYTRVAVWGNK

• Structural information:
  • Protein Domains: (2..8-)
    (/note="GST-N-terminal)
    (90..20-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR004046   IPR003081  IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 4GTU
  • PDBsum: 4GTU
  • STRING: ENSP00000358851
• Other Databases: GeneCards:  GSTM4  Malacards:  GSTM4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0042759	long-chain fatty acid biosynthetic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042178	xenobiotic catabolic process	IEA	biological process
GO:0018916	nitrobenzene metabolic process	IEA	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0043295	glutathione binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0042178	xenobiotic catabolic process	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004464	leukotriene-C4 synthase activity	IDA	molecular function
GO:0042759	long-chain fatty acid biosynthetic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016829	lyase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004464	leukotriene-C4 synthase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0042759	long-chain fatty acid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042178	xenobiotic catabolic process	IEA	biological process
GO:0018916	nitrobenzene metabolic process	IEA	biological process
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0043295	glutathione binding	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0042178	xenobiotic catabolic process	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045171	intercellular bridge	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881