• Gene id: 2941

Gene Summary

• Gene Symbol: GSTA4   Gene   UCSC   Ensembl
• Aliases: GSTA4-4, GTA4
• Gene name: glutathione S-transferase alpha 4
• Alternate names: glutathione S-transferase A4, GST class-alpha member 4, S-(hydroxyalkyl)glutathione lyase A4, glutathione S-alkyltransferase A4, glutathione S-aralkyltransferase A4, glutathione S-aryltransferase A4, glutathione S-transferase A4-4, glutathione transferase A4-4,
• Gene location: 6p12.2 (52995331: 52977951)     Exons: 7     NC_000006.12
• Gene summary(Entrez): Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, e
• OMIM: 611772

Protein Summary

• Protein general information: O15217  
  • Name: Glutathione S transferase A4 (EC 2.5.1.18) (GST class alpha member 4) (Glutathione S transferase A4 4)
  • Length: 222  
  • Mass: 25704
  • Tissue specificity: Expressed at a high level in brain, placenta, and skeletal muscle and much lower in lung and liver.
• Sequence:

  MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYI
  ADKHNLFGKNLKERTLIDMYVEGTLDLLELLIMHPFLKPDDQQKEVVNMAQKAIIRYFPVFEKILRGHGQSFLVG
  NQLSLADVILLQTILALEEKIPNILSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

• Structural information:
  • Protein Domains: (3..8-)
    (/note="GST-N-terminal)
    (85..20-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR003080   IPR004046  IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 1GUL 1GUM 3IK7
  • PDBsum: 1GUL 1GUM 3IK7
  • STRING: ENSP00000360002
• Other Databases: GeneCards:  GSTA4  Malacards:  GSTA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IDA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray