• Gene id: 2940

Gene Summary

• Gene Symbol: GSTA3   Gene   UCSC   Ensembl
• Aliases: GSTA3-3, GTA3
• Gene name: glutathione S-transferase alpha 3
• Alternate names: glutathione S-transferase A3, GST class-alpha member 3, S-(hydroxyalkyl)glutathione lyase A3, glutathione S-alkyltransferase A3, glutathione S-aralkyltransferase A3, glutathione S-aryltransferase A3, glutathione S-transferase A3-3,
• Gene location: 6p12.2 (52909798: 52896645)     Exons: 9     NC_000006.12
• Gene summary(Entrez): Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, e
• OMIM: 606548

Protein Summary

• Protein general information: Q16772  
  • Name: Glutathione S transferase A3 (EC 2.5.1.18) (GST class alpha member 3) (Glutathione S transferase A3 3)
  • Length: 222  
  • Mass: 25302
• Sequence:

  MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAEDLGKLRNDGSLMFQQVPMVEIDGMKLVQTRAILNYI
  ASKYNLYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAKIALIKEKTKSRYFPAFEKVLQSHGQDYLVG
  NKLSRADISLVELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQPGSPRKPPADAKALEEARKIFRF

• Structural information:
  • Protein Domains: (3..8-)
    (/note="GST-N-terminal)
    (85..20-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR003080   IPR004046  IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 1TDI 2VCV
  • PDBsum: 1TDI 2VCV
  • STRING: ENSP00000211122
• Other Databases: GeneCards:  GSTA3  Malacards:  GSTA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006749	glutathione metabolic process	ISS	biological process
GO:0004364	glutathione transferase activity	ISS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0006749	glutathione metabolic process	ISS	biological process
GO:0004364	glutathione transferase activity	ISS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881