• Gene id: 2939

Gene Summary

• Gene Symbol: GSTA2   Gene   UCSC   Ensembl
• Aliases: GST2, GSTA2-2, GTA2, GTH2
• Gene name: glutathione S-transferase alpha 2
• Alternate names: glutathione S-transferase A2, GST HA subunit 2, GST class-alpha member 2, GST-gamma, S-(hydroxyalkyl)glutathione lyase A2, glutathione S-alkyltransferase A2, glutathione S-aralkyltransferase A2, glutathione S-aryltransferase A2, liver GST2, testis tissue sperm-bin,
• Gene location: 6p12.2 (52763474: 52750086)     Exons: 8     NC_000006.12
• Gene summary(Entrez): Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and pro
• OMIM: 603288

Protein Summary

• Protein general information: P09210  
  • Name: Glutathione S transferase A2 (EC 2.5.1.18) (GST HA subunit 2) (GST class alpha member 2) (GST gamma) (GSTA2 2) (GTH2)
  • Length: 222  
  • Mass: 25664
  • Tissue specificity: Liver.
• Sequence:

  MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYI
  ASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFSQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVG
  NKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

• Structural information:
  • Protein Domains: (3..8-)
    (/note="GST-N-terminal)
    (85..20-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR003080   IPR004046  IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 1AGS 2VCT 2WJU 4ACS
  • PDBsum: 1AGS 2VCT 2WJU 4ACS
  • STRING: ENSP00000420168
• Other Databases: GeneCards:  GSTA2  Malacards:  GSTA2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0006749	glutathione metabolic process	ISS	biological process
GO:0004364	glutathione transferase activity	ISS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0004364	glutathione transferase activity	TAS	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0035722	interleukin-12-mediated signaling pathway	TAS	biological process
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray