• Gene id: 2938

Gene Summary

• Gene Symbol: GSTA1   Gene   UCSC   Ensembl
• Aliases: GST-epsilon, GST2, GSTA1-1, GTH1
• Gene name: glutathione S-transferase alpha 1
• Alternate names: glutathione S-transferase A1, 13-hydroperoxyoctadecadienoate peroxidase, GST HA subunit 1, GST class-alpha member 1, S-(hydroxyalkyl)glutathione lyase A1, androst-5-ene-3,17-dione isomerase, glutathione S-alkyltransferase A1, glutathione S-aryltransferase A1, glu,
• Gene location: 6p12.2 (35278557: 35317492)     Exons: 9     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of a family of enzymes that function to add glutathione to target electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. This action is an important step in det
• OMIM: 138359

Protein Summary

• Protein general information: P08263  
  • Name: Glutathione S transferase A1 (EC 2.5.1.18) (13 hydroperoxyoctadecadienoate peroxidase) (EC 1.11.1. ) (Androst 5 ene 3,17 dione isomerase) (EC 5.3.3. ) (GST HA subunit 1) (GST class alpha member 1) (GST epsilon) (GSTA1 1) (GTH1) [Cleaved into: Glutathione
  • Length: 222  
  • Mass: 25631
  • Tissue specificity: Liver.
• Sequence:

  MAEKPKLHYFNARGRMESTRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYI
  ASKYNLYGKDIKERALIDMYIEGIADLGEMILLLPVCPPEEKDAKLALIKEKIKNRYFPAFEKVLKSHGQDYLVG
  NKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEEARKIFRF

• Structural information:
  • Protein Domains: (3..8-)
    (/note="GST-N-terminal)
    (85..20-)
    (/note="GST-C-terminal")
  • Interpro: IPR010987  IPR036282  IPR040079  IPR004045  IPR003080   IPR004046  IPR036249  
  • Prosite: PS50405 PS50404
  • PDB: 1GSD 1GSE 1GSF 1GUH 1K3L 1K3O 1K3Y 1LBK 1PKW 1PKZ 1PL1 1PL2 1USB 1XWG 1YDK 2R3X 2R6K 3I69 3I6A 3IK9 3KTL 3L0H 3Q74 3U6V 3ZFB 3ZFL 4HJ2 5JCU 5LCZ 5LD0 6ATO 6ATP 6ATQ 6ATR
  • PDBsum: 1GSD 1GSE 1GSF 1GUH 1K3L 1K3O 1K3Y 1LBK 1PKW 1PKZ 1PL1 1PL2 1USB 1XWG 1YDK 2R3X 2R6K 3I69 3I6A 3IK9 3KTL 3L0H 3Q74 3U6V 3ZFB 3ZFL 4HJ2 5JCU 5LCZ 5LD0 6ATO 6ATP 6ATQ 6ATR
  • STRING: ENSP00000335620
• Other Databases: GeneCards:  GSTA1  Malacards:  GSTA1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006805	xenobiotic metabolic process	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0006749	glutathione metabolic process	IBA	biological process
GO:0004364	glutathione transferase activity	IBA	molecular function
GO:0004769	steroid delta-isomerase activity	IDA	molecular function
GO:0006693	prostaglandin metabolic process	IDA	biological process
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:1901687	glutathione derivative biosynthetic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0004601	peroxidase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016853	isomerase activity	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004364	glutathione transferase activity	IEA	molecular function
GO:0006749	glutathione metabolic process	IDA	biological process
GO:0004364	glutathione transferase activity	IDA	molecular function
GO:1901687	glutathione derivative biosynthetic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005504	fatty acid binding	IPI	molecular function
GO:0004602	glutathione peroxidase activity	IDA	molecular function
GO:0043651	linoleic acid metabolic process	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0098869	cellular oxidant detoxification	IEA	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0030855	epithelial cell differentiation	IEP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004364	glutathione transferase activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05200	Pathways in cancer
hsa05225	Hepatocellular carcinoma
hsa05418	Fluid shear stress and atherosclerosis
hsa00983	Drug metabolism - other enzymes
hsa05204	Chemical carcinogenesis
hsa00980	Metabolism of xenobiotics by cytochrome P450
hsa00982	Drug metabolism - cytochrome P450
hsa01524	Platinum drug resistance
hsa00480	Glutathione metabolism

Diseases

Associated diseases	References
Ovarian cancer	PMID:19786980
Asthma	PMID:20374258
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R