• Gene id: 2935

Gene Summary

• Gene Symbol: GSPT1   Gene   UCSC   Ensembl
• Aliases: 551G9.2, ETF3A, GST1, eRF3a
• Gene name: G1 to S phase transition 1
• Alternate names: eukaryotic peptide chain release factor GTP-binding subunit ERF3A, G1 to S phase transition protein 1 homolog, eukaryotic peptide chain release factor subunit 3a, eukaryotic release factor 3a,
• Gene location: 16p13.13 (11916653: 11868127)     Exons: 16     NC_000016.10
• OMIM: 139259

Protein Summary

• Protein general information: P15170  
  • Name: Eukaryotic peptide chain release factor GTP binding subunit ERF3A (Eukaryotic peptide chain release factor subunit 3a) (eRF3a) (G1 to S phase transition protein 1 homolog)
  • Length: 499  
  • Mass: 55756
• Sequence:

  MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHV
  NVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETE
  KKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDP
  TVNWSNERYEECKEKLVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG
  PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEIL
  PGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQD
  QVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD

• Structural information:
  • Protein Domains: (72..29-)
    (/note="tr-type-G)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01059"-)
  • Interpro: IPR004161  IPR031157  IPR027417  IPR000795  IPR009000   IPR009001  IPR004160  
  • Prosite: PS00301 PS51722
  • PDB: 3E1Y 3J5Y 3KUI 4D61 5HXB 5LZT
  • PDBsum: 3E1Y 3J5Y 3KUI 4D61 5HXB 5LZT
  • STRING: ENSP00000398131
• Other Databases: GeneCards:  GSPT1  Malacards:  GSPT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0018444	translation release factor complex	IBA	cellular component
GO:0006412	translation	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0003747	translation release factor activity	IBA	molecular function
GO:0002184	cytoplasmic translational termination	IBA	biological process
GO:0006449	regulation of translational termination	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	IEA	biological process
GO:0006412	translation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006479	protein methylation	IDA	biological process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0003747	translation release factor activity	IMP	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	TAS	biological process
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 21412036
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)