• Gene id: 2932

Gene Summary

• Gene Symbol: GSK3B   Gene   UCSC   Ensembl
• Gene name: glycogen synthase kinase 3 beta
• Alternate names: glycogen synthase kinase-3 beta, GSK-3 beta, GSK3beta isoform, serine/threonine-protein kinase GSK3B,
• Gene location: 3q13.33 (120095822: 119821320)     Exons: 13     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction,
• OMIM: 605004

SNPs

rs10762738

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000010.11   g.76935709A>G
NC_000010.10   g.78695467A>G
NG_012270.1   g.707111T>C|SEQ=[A/G]|GENE=KCNMA1
KCNMA1-AS1   101929328

Protein Summary

• Protein general information: P49841  
  • Name: Glycogen synthase kinase 3 beta (GSK 3 beta) (EC 2.7.11.26) (Serine/threonine protein kinase GSK3B) (EC 2.7.11.1)
  • Length: 420  
  • Mass: 46,744
  • Tissue specificity: Endothelial cells. {ECO
• Sequence:

  MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKL
  CDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAK
  QTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAP
  ELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
  WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLAT
  ILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST

• Structural information:
  • Protein Domains: Protein (56-340)
  • Interpro: IPR033573  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • PDB: 1GNG 1H8F 1I09 1J1B 1J1C 1O6K 1O6L 1O9U 1PYX 1Q3D 1Q3W 1Q41 1Q4L 1Q5K 1R0E 1UV5 2JDO 2JDR 2JLD 2O5K 2OW3 2UW9 2X39 2XH5 3CQU 3CQW 3DU8 3E87 3E88 3E8D 3F7Z 3F88 3GB2 3I4B 3L1S 3M1S 3MV5 3OW4 3PUP 3Q3B 3QKK 3SAY 3SD0 3ZDI 3ZRK 3ZRL 3ZRM 4ACC 4ACD 4ACG 4ACH
  • PDBsum: 1GNG 1H8F 1I09 1J1B 1J1C 1O6K 1O6L 1O9U 1PYX 1Q3D 1Q3W 1Q41 1Q4L 1Q5K 1R0E 1UV5 2JDO 2JDR 2JLD 2O5K 2OW3 2UW9 2X39 2XH5 3CQU 3CQW 3DU8 3E87 3E88 3E8D 3F7Z 3F88 3GB2 3I4B 3L1S 3M1S 3MV5 3OW4 3PUP 3Q3B 3QKK 3SAY 3SD0 3ZDI 3ZRK 3ZRL 3ZRM 4ACC 4ACD 4ACG 4ACH
  • DIP: 878
  • STRING: ENSP00000324806
• Other Databases: GeneCards:  GSK3B  Malacards:  GSK3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000320	re-entry into mitotic cell cycle	IEA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001837	epithelial to mesenchymal transition	IMP	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IMP	biological process
GO:0002039	p53 binding	IDA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005977	glycogen metabolic process	IDA	biological process
GO:0006349	regulation of gene expression by genetic imprinting	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006611	protein export from nucleus	IEA	biological process
GO:0006983	ER overload response	IDA	biological process
GO:0007212	dopamine receptor signaling pathway	NAS	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0007520	myoblast fusion	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0010614	negative regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	IEA	biological process
GO:0014043	negative regulation of neuron maturation	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016477	cell migration	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0021766	hippocampus development	IMP	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030529	intracellular ribonucleoprotein complex	IEA	cellular component
GO:0030877	beta-catenin destruction complex	TAS	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	TAS	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0031333	negative regulation of protein complex assembly	IMP	biological process
GO:0031334	positive regulation of protein complex assembly	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032092	positive regulation of protein binding	ISS	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IC	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0032886	regulation of microtubule-based process	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0035372	protein localization to microtubule	IEA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IEA	biological process
GO:0036016	cellular response to interleukin-3	ISS	biological process
GO:0036018	cellular response to erythropoietin	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0044027	hypermethylation of CpG island	IEA	biological process
GO:0044337	canonical Wnt signaling pathway involved in positive regulation of apoptotic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045719	negative regulation of glycogen biosynthetic process	TAS	biological process
GO:0045732	positive regulation of protein catabolic process	IC	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0048156	tau protein binding	IEA	molecular function
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0050774	negative regulation of dendrite morphogenesis	IEA	biological process
GO:0051001	negative regulation of nitric-oxide synthase activity	IEA	biological process
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0051534	negative regulation of NFAT protein import into nucleus	IMP	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IC	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0071109	superior temporal gyrus development	IMP	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0071282	cellular response to iron(II) ion	IEA	biological process
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0071871	response to epinephrine	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IC	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:0099565	chemical synaptic transmission, postsynaptic	NAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1900181	negative regulation of protein localization to nucleus	ISS	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	ISS	biological process
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:1902065	response to L-glutamate	IEA	biological process
GO:1903351	cellular response to dopamine	IEA	biological process
GO:1904339	negative regulation of dopaminergic neuron differentiation	TAS	biological process
GO:1904885	beta-catenin destruction complex assembly	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:1990418	response to insulin-like growth factor stimulus	IEA	biological process
GO:1990478	response to ultrasound	IEA	biological process
GO:1990776	response to angiotensin	IEA	biological process
GO:1990909	Wnt signalosome	TAS	cellular component
GO:2000077	negative regulation of type B pancreatic cell development	TAS	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:2000466	negative regulation of glycogen (starch) synthase activity	TAS	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IEA	biological process
GO:2000738	positive regulation of stem cell differentiation	IEA	biological process
GO:2001223	negative regulation of neuron migration	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0000320	re-entry into mitotic cell cycle	IEA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001837	epithelial to mesenchymal transition	IMP	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IMP	biological process
GO:0002039	p53 binding	IDA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005975	carbohydrate metabolic process	IEA	biological process
GO:0005977	glycogen metabolic process	IEA	biological process
GO:0005977	glycogen metabolic process	IDA	biological process
GO:0006349	regulation of gene expression by genetic imprinting	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006611	protein export from nucleus	IEA	biological process
GO:0006983	ER overload response	IEA	biological process
GO:0006983	ER overload response	IDA	biological process
GO:0007163	establishment or maintenance of cell polarity	IEA	biological process
GO:0007212	dopamine receptor signaling pathway	NAS	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007409	axonogenesis	IEA	biological process
GO:0007520	myoblast fusion	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0007623	circadian rhythm	IEA	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008134	transcription factor binding	IEA	molecular function
GO:0009887	animal organ morphogenesis	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0010226	response to lithium ion	IEA	biological process
GO:0010614	negative regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0010800	positive regulation of peptidyl-threonine phosphorylation	IEA	biological process
GO:0010918	positive regulation of mitochondrial membrane potential	IEA	biological process
GO:0010975	regulation of neuron projection development	IEA	biological process
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0014043	negative regulation of neuron maturation	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0014902	myotube differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0016310	phosphorylation	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0018105	peptidyl-serine phosphorylation	IEA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0021766	hippocampus development	IMP	biological process
GO:0030010	establishment of cell polarity	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030424	axon	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030516	regulation of axon extension	IEA	biological process
GO:0030529	intracellular ribonucleoprotein complex	IEA	cellular component
GO:0030877	beta-catenin destruction complex	IEA	cellular component
GO:0030877	beta-catenin destruction complex	TAS	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	TAS	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0031333	negative regulation of protein complex assembly	IMP	biological process
GO:0031334	positive regulation of protein complex assembly	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032092	positive regulation of protein binding	IEA	biological process
GO:0032092	positive regulation of protein binding	ISS	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IC	biological process
GO:0032868	response to insulin	IEA	biological process
GO:0032886	regulation of microtubule-based process	IEA	biological process
GO:0032886	regulation of microtubule-based process	IMP	biological process
GO:0033138	positive regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0034392	negative regulation of smooth muscle cell apoptotic process	IEA	biological process
GO:0035255	ionotropic glutamate receptor binding	IEA	molecular function
GO:0035372	protein localization to microtubule	IEA	biological process
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0035729	cellular response to hepatocyte growth factor stimulus	IEA	biological process
GO:0036016	cellular response to interleukin-3	IEA	biological process
GO:0036016	cellular response to interleukin-3	ISS	biological process
GO:0036018	cellular response to erythropoietin	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0043025	neuronal cell body	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0043198	dendritic shaft	IEA	cellular component
GO:0043227	membrane-bounded organelle	IEA	cellular component
GO:0043234	protein complex	IEA	cellular component
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0044027	hypermethylation of CpG island	IEA	biological process
GO:0044297	cell body	IEA	cellular component
GO:0044337	canonical Wnt signaling pathway involved in positive regulation of apoptotic process	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045719	negative regulation of glycogen biosynthetic process	TAS	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IC	biological process
GO:0045773	positive regulation of axon extension	IEA	biological process
GO:0045944	positive regulation of transcription from RNA polymerase II promoter	IEA	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0048156	tau protein binding	IEA	molecular function
GO:0048168	regulation of neuronal synaptic plasticity	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048511	rhythmic process	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0048814	regulation of dendrite morphogenesis	IEA	biological process
GO:0050321	tau-protein kinase activity	IEA	molecular function
GO:0050321	tau-protein kinase activity	IEA	molecular function
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0050770	regulation of axonogenesis	IEA	biological process
GO:0050774	negative regulation of dendrite morphogenesis	IEA	biological process
GO:0051001	negative regulation of nitric-oxide synthase activity	IEA	biological process
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0051534	negative regulation of NFAT protein import into nucleus	IMP	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IC	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0071109	superior temporal gyrus development	IMP	biological process
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0071282	cellular response to iron(II) ion	IEA	biological process
GO:0071285	cellular response to lithium ion	IEA	biological process
GO:0071871	response to epinephrine	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IC	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:0099565	chemical synaptic transmission, postsynaptic	NAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1900181	negative regulation of protein localization to nucleus	ISS	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IEA	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	ISS	biological process
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:1902065	response to L-glutamate	IEA	biological process
GO:1903351	cellular response to dopamine	IEA	biological process
GO:1904339	negative regulation of dopaminergic neuron differentiation	IEA	biological process
GO:1904339	negative regulation of dopaminergic neuron differentiation	TAS	biological process
GO:1904885	beta-catenin destruction complex assembly	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:1990418	response to insulin-like growth factor stimulus	IEA	biological process
GO:1990478	response to ultrasound	IEA	biological process
GO:1990776	response to angiotensin	IEA	biological process
GO:1990909	Wnt signalosome	IEA	cellular component
GO:1990909	Wnt signalosome	TAS	cellular component
GO:2000077	negative regulation of type B pancreatic cell development	TAS	biological process
GO:2000171	negative regulation of dendrite development	IEA	biological process
GO:2000463	positive regulation of excitatory postsynaptic potential	IEA	biological process
GO:2000466	negative regulation of glycogen (starch) synthase activity	TAS	biological process
GO:2000573	positive regulation of DNA biosynthetic process	IEA	biological process
GO:2000738	positive regulation of stem cell differentiation	IEA	biological process
GO:2001223	negative regulation of neuron migration	IEA	biological process
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001837	epithelial to mesenchymal transition	IMP	biological process
GO:0001954	positive regulation of cell-matrix adhesion	IMP	biological process
GO:0002039	p53 binding	IDA	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004672	protein kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	ISS	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0004674	protein serine/threonine kinase activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005977	glycogen metabolic process	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0006983	ER overload response	IDA	biological process
GO:0007212	dopamine receptor signaling pathway	NAS	biological process
GO:0007623	circadian rhythm	ISS	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	IDA	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0016301	kinase activity	TAS	molecular function
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018105	peptidyl-serine phosphorylation	IDA	biological process
GO:0018107	peptidyl-threonine phosphorylation	IDA	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0021766	hippocampus development	IMP	biological process
GO:0030877	beta-catenin destruction complex	TAS	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	TAS	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0030877	beta-catenin destruction complex	IDA	cellular component
GO:0031333	negative regulation of protein complex assembly	IMP	biological process
GO:0031334	positive regulation of protein complex assembly	IDA	biological process
GO:0031625	ubiquitin protein ligase binding	IPI	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032092	positive regulation of protein binding	ISS	biological process
GO:0032436	positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IC	biological process
GO:0032886	regulation of microtubule-based process	IMP	biological process
GO:0034236	protein kinase A catalytic subunit binding	IPI	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0036016	cellular response to interleukin-3	ISS	biological process
GO:0043066	negative regulation of apoptotic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	TAS	biological process
GO:0043547	positive regulation of GTPase activity	IMP	biological process
GO:0045719	negative regulation of glycogen biosynthetic process	TAS	biological process
GO:0045732	positive regulation of protein catabolic process	IC	biological process
GO:0046777	protein autophosphorylation	IDA	biological process
GO:0046827	positive regulation of protein export from nucleus	IDA	biological process
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0050321	tau-protein kinase activity	IDA	molecular function
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0051534	negative regulation of NFAT protein import into nucleus	IMP	biological process
GO:0060070	canonical Wnt signaling pathway	IDA	biological process
GO:0060070	canonical Wnt signaling pathway	IC	biological process
GO:0071109	superior temporal gyrus development	IMP	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IC	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	TAS	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	ISS	biological process
GO:0099565	chemical synaptic transmission, postsynaptic	NAS	biological process
GO:1900034	regulation of cellular response to heat	TAS	biological process
GO:1900181	negative regulation of protein localization to nucleus	ISS	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	ISS	biological process
GO:1901216	positive regulation of neuron death	IDA	biological process
GO:1904339	negative regulation of dopaminergic neuron differentiation	TAS	biological process
GO:1904885	beta-catenin destruction complex assembly	TAS	biological process
GO:1904886	beta-catenin destruction complex disassembly	TAS	biological process
GO:1990909	Wnt signalosome	TAS	cellular component
GO:2000077	negative regulation of type B pancreatic cell development	TAS	biological process
GO:2000466	negative regulation of glycogen (starch) synthase activity	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa04150	mTOR signaling pathway
hsa04110	Cell cycle
hsa04510	Focal adhesion
hsa04550	Signaling pathways regulating pluripotency of stem cells
hsa04660	T cell receptor signaling pathway
hsa04657	IL-17 signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04062	Chemokine signaling pathway
hsa04910	Insulin signaling pathway
hsa04917	Prolactin signaling pathway
hsa04919	Thyroid hormone signaling pathway
hsa04916	Melanogenesis
hsa04728	Dopaminergic synapse
hsa04722	Neurotrophin signaling pathway
hsa04360	Axon guidance
hsa05200	Pathways in cancer
hsa05210	Colorectal cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05217	Basal cell carcinoma
hsa05215	Prostate cancer
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05010	Alzheimer disease
hsa04932	Non-alcoholic fatty liver disease
hsa04931	Insulin resistance
hsa04934	Cushing syndrome
hsa05135	Yersinia infection
hsa05162	Measles
hsa05160	Hepatitis C
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05165	Human papillomavirus infection
hsa01521	EGFR tyrosine kinase inhibitor resistance

Diseases

Associated diseases	References
Cancer	GAD: 19657367
Cancer (bladder)	GAD: 19692168
Cancer (esophageal)	GAD: 20453000
Cancer (Hepatocellular)	GAD: 12969793
Cancer (lung)	GAD: 18676680
Cancer (stomach)	GAD: 17160944
Cancer (breast)	GAD: 18708403
Hypercholesterolemia	GAD: 20602615
Bone diseases	GAD: 19453261
Alzheimer's disease	GAD: 16428884
Parkinson disease	GAD: 16315267
Major depressive disorder	GAD: 20033742
Psychological disorders	GAD: 20015462
Schizophrenia	GAD: 15719395
Bipolar disorder	GAD: 16289783
Bipolar disorder	GAD: 16397405
Bulimia	GAD: 20468064
Depression	GAD: 20015462
Polycystic ovary syndrome (PCOS)	INFBASE: 25117097
Endometriosis	INFBASE: 25194152
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Spermatogenesis defects	MIK: 26209830
Varicocele	MIK: 26209830
Male factor infertility	MIK: 26209830
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Acrosomal exocytosis in mouse spermatozoa	MIK: 25808536
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 22228739
Semen quality	MIK: 26209830
Sperm motility	MIK: 26209830
Teratozoospermia	MIK: 17327269
Varicocele	MIK: 26209830

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
26209830	Varicocele			37	Male infertility
26209830	Semen quality, Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase
26209830	Varicocele, Spermatogenetic defects			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR p38 MAPK p53PARP Caspase-3 Akt Stat1 and p70 S6 kinase
26209830	Sperm motility			37 men provided semen samples for routine analysis	Male infertility	Bad GSK-3 HSP27 JNK/SAPK mTOR  p38 MAPK p53 PARP Caspase-3
12721208	Role in mammalian meiosis and spermatogenesis				Male infertility
25808536	Acrosomal exocytosis in mouse spermatozoa				Male infertility
22228739	Decreased spermatogenesis, sperm maturation				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray